BYKdb

Annotate results for A0A0E3ZG78

A0A0E3ZG78 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0E3ZG78
DOMAINtad15/257GEKDIRRILLNYLRYWYLFLIGAALGLCGAFLYLRYYTIPKYSVYSTVLIKDDKSDSHLS
NESAFSDLEIFQATKNINNEIEVLQSESLMKRVASELSLFIGYYIEGRVNDIEIYGSEVP
IKVLVNDLAPPAYRKSFVIHIKSDSTYNLDDNEGKMYTYKFGQQIQKPYGVFTVVPDSGL
TASSKSIGSKLTVKFKNVQQLAEHYSQAIQIGPVNKSASVLWVGLTDPIPEKAKDIVNKL
IEV
DOMAINcd587/776TSSMSGEGKTFFAINLAASLVLTGKKVLLIDLDLRKSTLSDELGLSEEGIGVSDYLVSNN
VPIHEIIRSSAKVTDLFVISSGPTPPDPTELMMSTKLADLILELKSSFDFIIIDTAPVGQ
VADALSISSVIDSTIYIVRYNYTKKRQIEIVDEIYRNKTLCHPMIVLNDSKHVSSYGYGY
GYCYSKEEKK
SITEWalker A594/596GKT
SITEWalker A'614/621LLIDLDLR
SITEWalker B697/703IIIDTAP
SITE-722/-728YIVRYNY
SITEY Cluster762/770YGYGYGYCY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMDKELFPLSSERAGEKDIRRILLNYLRYWYLFLIGAALGLCGAFLYLRYYTIPKYSVYSTVLIKDDKSDSHLSNESAFS
              GEKDIRRILLNYLRYWYLFLIGAALGLCGAFLYLRYYTIPKYSVYSTVLIKDDKSDSHLSNESAFS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLEIFQATKNINNEIEVLQSESLMKRVASELSLFIGYYIEGRVNDIEIYGSEVPIKVLVNDLAPPAYRKSFVIHIKSDST
DLEIFQATKNINNEIEVLQSESLMKRVASELSLFIGYYIEGRVNDIEIYGSEVPIKVLVNDLAPPAYRKSFVIHIKSDST

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNLDDNEGKMYTYKFGQQIQKPYGVFTVVPDSGLTASSKSIGSKLTVKFKNVQQLAEHYSQAIQIGPVNKSASVLWVGLT
YNLDDNEGKMYTYKFGQQIQKPYGVFTVVPDSGLTASSKSIGSKLTVKFKNVQQLAEHYSQAIQIGPVNKSASVLWVGLT

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPIPEKAKDIVNKLIEVYNKEAIEDKNLIASYTIDFIDERLRYLTSELSGVEKDVEQYKRQHELTDVNIQASNYLNIASG
DPIPEKAKDIVNKLIEV                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YNKQLSDWAIQIEILESIESYLNKDENQYKMVPSTLSIQDVTLMGLIARFNELQLDRERMLRTAQPKSPIIKNLNEQLAN


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRSSILENLRNIKKGLLITSNNLRANSDEFESKIKKVPSMERELLEISRQQAIKQNLYLYLLQKREETALSLAATVSSLR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIDPAKGGNVPVSPNKSTIYLMSLLLGICLPFAGIFIKDLLDDKVQTQQDVQHLTIAPVLGELPHNNYDTVVVTKGNRTP


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVEMFRHIRAKLHFAAVDKENKVILITSSMSGEGKTFFAINLAASLVLTGKKVLLIDLDLRKSTLSDELGLSEEGIGVSD
                          TSSMSGEGKTFFAINLAASLVLTGKKVLLIDLDLRKSTLSDELGLSEEGIGVSD
                                 GKT                 LLIDLDLR                   
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLVSNNVPIHEIIRSSAKVTDLFVISSGPTPPDPTELMMSTKLADLILELKSSFDFIIIDTAPVGQVADALSISSVIDST
YLVSNNVPIHEIIRSSAKVTDLFVISSGPTPPDPTELMMSTKLADLILELKSSFDFIIIDTAPVGQVADALSISSVIDST
                                                        IIIDTAP                 
       730       740       750       760       770       780   
....:....|....:....|....:....|....:....|....:....|....:....|...
IYIVRYNYTKKRQIEIVDEIYRNKTLCHPMIVLNDSKHVSSYGYGYGYCYSKEEKKDLSKKLI
IYIVRYNYTKKRQIEIVDEIYRNKTLCHPMIVLNDSKHVSSYGYGYGYCYSKEEKK       
                                         YGYGYGYCY             

© 1998-2019