BYKdb

Annotate results for A0A0E3ZGV6

A0A0E3ZGV6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0E3ZGV6
DOMAINtad9/241EDNLVASLVYKFLPFWPLFVVLFILSVAGAWAYLKFYATPTYAITASLIIRDEEKGVNAS
KITESIDAFSSNKIVENELNVLRSNALMNQVVNELKLYAPVYEETKLRSVPAYTSSPITI
TLKDPEKATENPMIFFTYDESSKEVIIDSKKYSIGTWEKTPYGVMLFSENEKQTSTTTNP
LYFSIISPTRAANQLSGSIFIESAGKLSSVVNLYLEDKVPERGEDILNALIHA
DOMAINcd572/760TSSIPGEGKSFVSTNLAISLSSSGKKVVILDFDLRNPNTSVLFENANQTGIIEYLKDNLD
PRDIIRSTSFDNLSMIPAGIDIGDHTELLLNSKMEELFSYLEESYDYVIIDTPPVDLVSD
AYLLSEYCDISLLVIRHAYTPKSFIQRLSQNNKLRSMGNVAIVFNGVKPRGFVKGQYGYG
YGYGYENKY
SITEWalker A579/581GKS
SITEWalker A'599/606VILDFDLR
SITEWalker B679/685VIIDTPP
SITE-671/-698YLEESYDYVIIDTPPVDLVSDAYLLSEY
SITEY Cluster748/765YGYGYGYGYENKYGDKTY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDKNKVNAEDNLVASLVYKFLPFWPLFVVLFILSVAGAWAYLKFYATPTYAITASLIIRDEEKGVNASKITESIDAFSSN
        EDNLVASLVYKFLPFWPLFVVLFILSVAGAWAYLKFYATPTYAITASLIIRDEEKGVNASKITESIDAFSSN

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIVENELNVLRSNALMNQVVNELKLYAPVYEETKLRSVPAYTSSPITITLKDPEKATENPMIFFTYDESSKEVIIDSKKY
KIVENELNVLRSNALMNQVVNELKLYAPVYEETKLRSVPAYTSSPITITLKDPEKATENPMIFFTYDESSKEVIIDSKKY

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIGTWEKTPYGVMLFSENEKQTSTTTNPLYFSIISPTRAANQLSGSIFIESAGKLSSVVNLYLEDKVPERGEDILNALIH
SIGTWEKTPYGVMLFSENEKQTSTTTNPLYFSIISPTRAANQLSGSIFIESAGKLSSVVNLYLEDKVPERGEDILNALIH

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AYQKAAVTEKNSLVSQTLAFVEERIQLIEKELQNLEDKIVKYKSTQGAVNLNEQGKLFLQSVDNNDRRLNEINLQLAVLD
A                                                                               

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVERYVVRKNKDLGIVPSTLGVSDPVLSQLLQKLYNSEIQYQQLSKTTAENNPLLVSLREEIESIRPGILENIRNQRDNL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSSRSKLSSTNSSYSSVLQSIPRKERELLEISRQQAIKNNAYSFLLQKREETMLSYAPTAEDIRVVDMAESSKTPVSPNA


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LYVYLSAVVLALAGGVALVTGKEMLHSKVLFRSEIEAYLNAPIVAELSTVKNHDKNLPLQPAEVAQVEQFRQLRVTMGLY


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRTFTRRKIMVTSSIPGEGKSFVSTNLAISLSSSGKKVVILDFDLRNPNTSVLFENANQTGIIEYLKDNLDPRDIIRSTS
           TSSIPGEGKSFVSTNLAISLSSSGKKVVILDFDLRNPNTSVLFENANQTGIIEYLKDNLDPRDIIRSTS
                  GKS                 VILDFDLR                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDNLSMIPAGIDIGDHTELLLNSKMEELFSYLEESYDYVIIDTPPVDLVSDAYLLSEYCDISLLVIRHAYTPKSFIQRLS
FDNLSMIPAGIDIGDHTELLLNSKMEELFSYLEESYDYVIIDTPPVDLVSDAYLLSEYCDISLLVIRHAYTPKSFIQRLS
                                      VIIDTPP                                   
       730       740       750       760       770    
....:....|....:....|....:....|....:....|....:....|....
QNNKLRSMGNVAIVFNGVKPRGFVKGQYGYGYGYGYENKYGDKTYRARKLATKS
QNNKLRSMGNVAIVFNGVKPRGFVKGQYGYGYGYGYENKY              
                           YGYGYGYGYENKYGDKTY         

© 1998-2019