BYKdb

Annotate results for A0A0E4CSD9

A0A0E4CSD9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0E4CSD9
DOMAINcd41/230TSVQPGEGKSTTSTSLAISFATSGYKTLLIDADIRNSVMSGTFKAESAYHGLTSYLSGHV
DLSQVVHDTSIDNLSIIPAGQVPPNPTTFLQNARFDNMIERVRNGFDYIIIDTPPIGLVV
DAAIVAQKADGSLLVTESGAVSRRFVKKAVEQMEQSGAQFLGVILNKVDTTKDRYGSYGS
YGAYGNYGNY
SITEWalker A48/50GKS
SITEWalker A'68/75LLIDADIR
SITEWalker B149/155IIIDTPP
SITE-89/-95YHGLTSY
SITEY Cluster215/230YGSYGSYGAYGNYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSQFILGRAKAQMVKAMEEYYNAIQVNIQFSGSNIKVIAVTSVQPGEGKSTTSTSLAISFATSGYKTLLIDADIRNSVMS
                                        TSVQPGEGKSTTSTSLAISFATSGYKTLLIDADIRNSVMS
                                               GKS                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTFKAESAYHGLTSYLSGHVDLSQVVHDTSIDNLSIIPAGQVPPNPTTFLQNARFDNMIERVRNGFDYIIIDTPPIGLVV
GTFKAESAYHGLTSYLSGHVDLSQVVHDTSIDNLSIIPAGQVPPNPTTFLQNARFDNMIERVRNGFDYIIIDTPPIGLVV
                                                                    IIIDTPP     
       170       180       190       200       210       220       230        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
DAAIVAQKADGSLLVTESGAVSRRFVKKAVEQMEQSGAQFLGVILNKVDTTKDRYGSYGSYGAYGNYGNYGKKTDKDL
DAAIVAQKADGSLLVTESGAVSRRFVKKAVEQMEQSGAQFLGVILNKVDTTKDRYGSYGSYGAYGNYGNY        
                                                      YGSYGSYGAYGNYGNY        
© 1998-2019