BYKdb

Annotate results for A0A0E9FNN9

A0A0E9FNN9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0E9FNN9
DOMAINcd37/233VSTAPNEGKSTVSTNLARIMAAKYKNVLLIDCDLRNPSVHKLLHISNRSGLSNIMSQFKE
ETPVREYDGVQEHVFPNGETLSVITTGHKVPNPSEVLGSRRLGAFLNQARKSFGYIILDC
PPIAVSSDSIPVCNVSDGVLFVVDSKTADKRKVKSAINDVQRNGGNVFGIVLNKVEEFSD
KHYGYGYGYGYGQEDKD
SITEWalker A44/46GKS
SITEWalker A'64/71LLIDCDLR
SITEWalker B152/158IILDCPP
SITEY Cluster219/227YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKKKRNQFDVDEIYRGLRTNIEFSQMDDKIQVINVVSTAPNEGKSTVSTNLARIMAAKYKNVLLIDCDLRNPSVHKLLH
                                    VSTAPNEGKSTVSTNLARIMAAKYKNVLLIDCDLRNPSVHKLLH
                                           GKS                 LLIDCDLR         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ISNRSGLSNIMSQFKEETPVREYDGVQEHVFPNGETLSVITTGHKVPNPSEVLGSRRLGAFLNQARKSFGYIILDCPPIA
ISNRSGLSNIMSQFKEETPVREYDGVQEHVFPNGETLSVITTGHKVPNPSEVLGSRRLGAFLNQARKSFGYIILDCPPIA
                                                                       IILDCPP  
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
VSSDSIPVCNVSDGVLFVVDSKTADKRKVKSAINDVQRNGGNVFGIVLNKVEEFSDKHYGYGYGYGYGQEDKDNA
VSSDSIPVCNVSDGVLFVVDSKTADKRKVKSAINDVQRNGGNVFGIVLNKVEEFSDKHYGYGYGYGYGQEDKD  
                                                          YGYGYGYGY        
© 1998-2019