BYKdb

Annotate results for A0A0F0CSR3

A0A0F0CSR3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F0CSR3
DOMAINtad22/181REQDIKEYLSILYNRRWLIISFTLVLCTISLIRTFMMRPVYEATTKILIQKKAPRIIKID
EMDTTNYSASDTLFTQYKILESDFLAEKVFKTLGDYIPWDKWHGRKKINTSKPLTDLQKI
ETLLSHLKITPIPNTELVLIKFEDIDPVLSAKIANLWANS
DOMAINcd449/638TSSCPQEGKTTTAINLAVVMAMAGEKTLLVDADLRQPRIEKVFNLKDKLGLSDVLIGNAK
WEQMIIETNIKNLFILPAGSIPPNPSELLGSGKMTTFLEDIDKKYDRIIIDSPPVLAVTD
AVILSGKVDGTIIVARASHTHRHAICQAKELIETVDTAHIVGMILNMVSINIGSGYYYYY
YGKYGKYGKT
SITE-636/-638GKT
SITEWalker A'476/483LLVDADLR
SITEWalker B556/562IIIDSPP
SITEY Cluster624/635YYYYYYGKYGKY
SITEWalker A456/458GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGVKKKGNKNMPNSTQNPFLEREQDIKEYLSILYNRRWLIISFTLVLCTISLIRTFMMRPVYEATTKILIQKKAPRIIKI
                     REQDIKEYLSILYNRRWLIISFTLVLCTISLIRTFMMRPVYEATTKILIQKKAPRIIKI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DEMDTTNYSASDTLFTQYKILESDFLAEKVFKTLGDYIPWDKWHGRKKINTSKPLTDLQKIETLLSHLKITPIPNTELVL
DEMDTTNYSASDTLFTQYKILESDFLAEKVFKTLGDYIPWDKWHGRKKINTSKPLTDLQKIETLLSHLKITPIPNTELVL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKFEDIDPVLSAKIANLWANSYISYILDTRFDVSSYASGWLDDKIKEEKNNLETAEKTLQEYRKANTIIIDTVDEEHRVL
IKFEDIDPVLSAKIANLWANS                                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NKLLAKKSELEVLLSEKQEYYKAQHPEILGIKSELESIVKTIANEKTKELKIKDIEIEYNILLREVETRKEVYESLLKRI


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RETEITGGLKTTNVSILDIAQVPTKPTRPNKKLSLIITLFISVLSGSALAFLIEALDQTLKTPEDIKKFLNIPPLAGIPL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRDEEDKLISPEFITSKKPRSTIAEAYRSLRTSILFTAIEHKRKSLLLTSSCPQEGKTTTAINLAVVMAMAGEKTLLVDA
                                                TSSCPQEGKTTTAINLAVVMAMAGEKTLLVDA
                                                       GKT                 LLVDA
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRQPRIEKVFNLKDKLGLSDVLIGNAKWEQMIIETNIKNLFILPAGSIPPNPSELLGSGKMTTFLEDIDKKYDRIIIDS
DLRQPRIEKVFNLKDKLGLSDVLIGNAKWEQMIIETNIKNLFILPAGSIPPNPSELLGSGKMTTFLEDIDKKYDRIIIDS
DLR                                                                        IIIDS
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPVLAVTDAVILSGKVDGTIIVARASHTHRHAICQAKELIETVDTAHIVGMILNMVSINIGSGYYYYYYGKYGKYGKTPK
PPVLAVTDAVILSGKVDGTIIVARASHTHRHAICQAKELIETVDTAHIVGMILNMVSINIGSGYYYYYYGKYGKYGKT  
PP                                                             YYYYYYGKYGKY     
        
....:...
KNTTVSAS


© 1998-2019