BYKdb

Annotate results for A0A0F0KEG5

A0A0F0KEG5 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F0KEG5
DOMAINtad6/142TGWSLASAWGAVRKFWFVILGMALIGGAVGYGVSAATPPQYQSTATLYFAMNQGTTGTDL
NQGSTYTQSQMLSFAQLATSSRVLAPVIEDLDLALTPKELTRNIAITIPQDTTILGVEVT
STSAARATDIANAISEE
DOMAINcd274/457TSASPAEGKSTFSANLAVTLADLGENTLLIDADLRRPRIGEIFGLDASVGLTSVVLGSAA
LTEAVIPWREGGPDLLLSGEVPPNSASVLTSHAFAEVLGAASEGHDVVVIDSPPVLTVAD
TNLVAPLVDGVVIVVDASKTSRPQLAATIRTLEGAGAPIIGIVLNKVRLARGRTTYYTQE
DSPG
SITEWalker A281/283GKS
SITEWalker A'301/308LLIDADLR
SITEWalker B381/387VVIDSPP
SITEY Cluster449/450YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKADATGWSLASAWGAVRKFWFVILGMALIGGAVGYGVSAATPPQYQSTATLYFAMNQGTTGTDLNQGSTYTQSQMLSFA
     TGWSLASAWGAVRKFWFVILGMALIGGAVGYGVSAATPPQYQSTATLYFAMNQGTTGTDLNQGSTYTQSQMLSFA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLATSSRVLAPVIEDLDLALTPKELTRNIAITIPQDTTILGVEVTSTSAARATDIANAISEELSSAVEEIVAKGVDQKPT
QLATSSRVLAPVIEDLDLALTPKELTRNIAITIPQDTTILGVEVTSTSAARATDIANAISEE                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIPSVIDEAVVPQFQSLPNKTKDAGLAAVLGLILGVLVAFVATVADNRVRNEAALARVTDLPYLGSITRTKRGVTAGLIV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VREPRSHIAEDFRRVQSALAFANIDGQSRRLLITSASPAEGKSTFSANLAVTLADLGENTLLIDADLRRPRIGEIFGLDA
                                 TSASPAEGKSTFSANLAVTLADLGENTLLIDADLRRPRIGEIFGLDA
                                        GKS                 LLIDADLR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVGLTSVVLGSAALTEAVIPWREGGPDLLLSGEVPPNSASVLTSHAFAEVLGAASEGHDVVVIDSPPVLTVADTNLVAPL
SVGLTSVVLGSAALTEAVIPWREGGPDLLLSGEVPPNSASVLTSHAFAEVLGAASEGHDVVVIDSPPVLTVADTNLVAPL
                                                            VVIDSPP             
       410       420       430       440       450       
....:....|....:....|....:....|....:....|....:....|....:..
VDGVVIVVDASKTSRPQLAATIRTLEGAGAPIIGIVLNKVRLARGRTTYYTQEDSPG
VDGVVIVVDASKTSRPQLAATIRTLEGAGAPIIGIVLNKVRLARGRTTYYTQEDSPG
                                                YY       
© 1998-2019