BYKdb

Annotate results for A0A0F0KLV0

A0A0F0KLV0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F0KLV0
DOMAINtad4/140SRVSLRVIASSLRKFWWMIVLCGVIGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDL
NQGSVYTQSQMLSFAQLATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGI
TDDPKAAAELADAVADQ
DOMAINcd272/450TSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSIGLTSVLLDEVE
FEVAKHSVADSTLDILPAGTIPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVAD
ANLFATQTDGVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDHHRSEYYSD
SITEWalker A279/281GKS
SITEWalker A'299/306LLIDADMR
SITEWalker B379/385VVIDSPP
SITE-376/-378YDY
SITEY Cluster447/448YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGESRVSLRVIASSLRKFWWMIVLCGVIGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL
   SRVSLRVIASSLRKFWWMIVLCGVIGAAGSFGYASLQTPLFQATTSLYFALNQGTSASDLNQGSVYTQSQMLSFAQL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQLIIVVKDVAPKDPQGESTIT
ATSSRVLDPVIEELGLDTTPRALARDIEVTIPQSTVTLRITGITDDPKAAAELADAVADQ                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AQVIDDAVVPEFQFTPSKPRDALLGGFLGGVLGLAIAVLVGVLDTRMRNEETLAEAGGDPVLGVVSKSPLLAMRGIAVAQ


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPLGHTSEEFRRIRSALAYANVSSRVKVLLVTSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
                               TSGMPAEGKSTISVNLAMTLAGLRNSVLLIDADMRRPRAHEHAGIDGSI
                                      GKS                 LLIDADMR              
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
GLTSVLLDEVEFEVAKHSVADSTLDILPAGTIPPNPAELLTSARMAQLLDFAAAEYDYVVIDSPPILSVADANLFATQTD
                                                          VVIDSPP               
       410       420       430       440       450
....:....|....:....|....:....|....:....|....:....|
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDHHRSEYYSD
GVILVVDATKTRRAALAKSIKSLESGGARILGTVLNRARPDHHRSEYYSD
                                              YY  
© 1998-2019