BYKdb

Annotate results for A0A0F0KYJ9

A0A0F0KYJ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F0KYJ9
DOMAINcd23/212TSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMIGTVFGLPKGAGISDVLAGCAT
IAEVAQRFGNGQLLVVAAGKVPPNPSEVLGSARMRELLKSIAREAIVIVDAPPLVPVTDA
AVLAHSADGAIIVGTVGKTTYEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYGYQY
HGDYYRNDGQ
SITE-159/-161GKT
SITEWalker A'50/57VLIDGDLR
SITEWalker B129/135VIVDAPP
SITEY Cluster197/207YYGYQYHGDYY
SITEWalker A30/32GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRELRTNLVYMDVDNPPRIIVVTSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMIGTVFGLPKGAGISDVLAGC
                      TSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMIGTVFGLPKGAGISDVLAGC
                             GKS                 VLIDGDLR                       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATIAEVAQRFGNGQLLVVAAGKVPPNPSEVLGSARMRELLKSIAREAIVIVDAPPLVPVTDAAVLAHSADGAIIVGTVGK
ATIAEVAQRFGNGQLLVVAAGKVPPNPSEVLGSARMRELLKSIAREAIVIVDAPPLVPVTDAAVLAHSADGAIIVGTVGK
                                                VIVDAPP                         
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
TTYEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYGYQYHGDYYRNDGQELPTGTVRGDNANIYAKSK
TTYEVLGKAIGNLERAGARALGLVLNKVPRRGSGAAYYGYQYHGDYYRNDGQ                   
                                    YYGYQYHGDYY                        
© 1998-2019