BYKdb

Annotate results for A0A0F0KYQ2

A0A0F0KYQ2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F0KYQ2
DOMAINtad1/135MNLEDYGRLVRRHWGAIALSIGLGLAVAFGVSALMPKVYTADASGFVVSQSGGSTGIASL
GDAYAKSRAKSYVEIAKNRTIAQAVIGQLDLKTTPQTLVNQISASVPLDTVTLRITAQAA
TPQQAQDLANAWIRA
DOMAINcd288/476TSPVPGDGKSTVVANLALAIAESGRRVVLVDGDLRRPTVAESFGVSGAAGLTDVLVGSAQ
IGQVLQRTAWHRNLYLLTSGTVPPNPSELVGTQVMRDLLRELSEHAIVLVDAPPLLPVTD
GAILANQADGAIVVVRAGRTHIDELGKALSNLAKAGAVALGIVINRIPVKGMDRAGYGYY
GGGYVGKNA
SITEWalker A295/297GKS
SITEWalker A'315/322VLVDGDLR
SITEWalker B395/401VLVDAPP
SITEY Cluster464/471YGYYGGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNLEDYGRLVRRHWGAIALSIGLGLAVAFGVSALMPKVYTADASGFVVSQSGGSTGIASLGDAYAKSRAKSYVEIAKNRT
MNLEDYGRLVRRHWGAIALSIGLGLAVAFGVSALMPKVYTADASGFVVSQSGGSTGIASLGDAYAKSRAKSYVEIAKNRT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAQAVIGQLDLKTTPQTLVNQISASVPLDTVTLRITAQAATPQQAQDLANAWIRALAVEVQKLESGEVLTEGGAAAPAEG
IAQAVIGQLDLKTTPQTLVNQISASVPLDTVTLRITAQAATPQQAQDLANAWIRA                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPAGAAVVALVPGDTAVLPSAPSSPNLRLNLLLGALIGLALGIAWALVRSTVDKRIRSAAAVESTYDVSVVGTLPVDDVL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGAGRRLISTSSARADNEHLRLAEALRELRTNIQFLHVDDPPRVIVLTSPVPGDGKSTVVANLALAIAESGRRVVLVDGD
                                               TSPVPGDGKSTVVANLALAIAESGRRVVLVDGD
                                                      GKS                 VLVDGD
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRRPTVAESFGVSGAAGLTDVLVGSAQIGQVLQRTAWHRNLYLLTSGTVPPNPSELVGTQVMRDLLRELSEHAIVLVDAP
LRRPTVAESFGVSGAAGLTDVLVGSAQIGQVLQRTAWHRNLYLLTSGTVPPNPSELVGTQVMRDLLRELSEHAIVLVDAP
LR                                                                        VLVDAP
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLLPVTDGAILANQADGAIVVVRAGRTHIDELGKALSNLAKAGAVALGIVINRIPVKGMDRAGYGYYGGGYVGKNAGYVS
PLLPVTDGAILANQADGAIVVVRAGRTHIDELGKALSNLAKAGAVALGIVINRIPVKGMDRAGYGYYGGGYVGKNA    
P                                                              YGYYGGGY         
       490       
....:....|....:..
ANPDAAPLHEVLAEAER


© 1998-2019