BYKdb

Annotate results for A0A0F0L1W1

A0A0F0L1W1 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F0L1W1
DOMAINtad1/138MDIRDYLRALRRNWIAIILMTAVGLGAAYGWAKIQTPVYEASVSGLVKSRVTPTDPQQQL
AQSTDTYARAKVPTYLVMAGWRSVAVNAGSTLGLSDSPESLVKRITVTNPEATNIINIAA
TASSPKAAQQLADAWMKG
DOMAINcd278/463TSALPGEGKSTVAANLAMTLAAAGANVVLVDGDLRRPTVASTLGLVAGAGLTDVLAGRAK
LTEVAQTAPDIPNLAVLTAGTIPPNPSEVLGSARMHQLVKDLTKHATVIIDAPPVLAVTD
GAVLANQADGALLVVAVGKTTYDVVDKALNTLEKARGRVLGVVLNRVPVTGRQAGYAYDY
REKSSP
SITE-415/-417GKT
SITEWalker A'305/312VLVDGDLR
SITEWalker B385/391VIIDAPP
SITEY Cluster453/457YAYDY
SITEWalker A285/287GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDIRDYLRALRRNWIAIILMTAVGLGAAYGWAKIQTPVYEASVSGLVKSRVTPTDPQQQLAQSTDTYARAKVPTYLVMAG
MDIRDYLRALRRNWIAIILMTAVGLGAAYGWAKIQTPVYEASVSGLVKSRVTPTDPQQQLAQSTDTYARAKVPTYLVMAG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WRSVAVNAGSTLGLSDSPESLVKRITVTNPEATNIINIAATASSPKAAQQLADAWMKGLVSVIDDTDGIDRQPGTSPVMI
WRSVAVNAGSTLGLSDSPESLVKRITVTNPEATNIINIAATASSPKAAQQLADAWMKG                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YVAQTAALPEAPIFPSVPTALLIGGLLGLGGGIAFAMIRAISDRRVRGTDDVEQRLGVPVVGIIPKVDSVAAERRIVAED


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAHADSRTDFAVRESLRALRTNLQFMDVDHPPRTIVVTSALPGEGKSTVAANLAMTLAAAGANVVLVDGDLRRPTVASTL
                                     TSALPGEGKSTVAANLAMTLAAAGANVVLVDGDLRRPTVASTL
                                            GKS                 VLVDGDLR        
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLVAGAGLTDVLAGRAKLTEVAQTAPDIPNLAVLTAGTIPPNPSEVLGSARMHQLVKDLTKHATVIIDAPPVLAVTDGAV
GLVAGAGLTDVLAGRAKLTEVAQTAPDIPNLAVLTAGTIPPNPSEVLGSARMHQLVKDLTKHATVIIDAPPVLAVTDGAV
                                                                VIIDAPP         
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LANQADGALLVVAVGKTTYDVVDKALNTLEKARGRVLGVVLNRVPVTGRQAGYAYDYREKSSPKETAGKGGKSTDAASGP
LANQADGALLVVAVGKTTYDVVDKALNTLEKARGRVLGVVLNRVPVTGRQAGYAYDYREKSSP                 
                                                    YAYDY                       
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRTGAQPVPVVPADQGPLLPDEEASAQPVEETVAAPASKPRRATARAVRAARTAAPAERGKDPALAADPEAGDLDSLLGD


       570       
....:....|....:..
FIADDAATGPRRQRGRT


© 1998-2019