BYKdb

Annotate results for A0A0F0L851

A0A0F0L851 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F0L851
DOMAINtad1/136MELSDYFRILRAHWIVILVATVLGAGAAFGWSALQPRVYAADTTGIVTAVGGDGSSGAAL
VGNQLAQSRVKSYLNLGSWRAVAEHAIDDLGLEATPESLVSRVSVTNPTDTTALKVTATG
ATPETAQELAEAWMRG
DOMAINcd274/464TSSVPGDGKSTVAVNLASSLAAAGQWAILIDCDLRRPVIADIFGISRDVGLTDILAGRAE
LQDVAHRPNRDVPLAVLGAGRIPPNPSELLGSHRMQDFLAEISKTAIVILDSPPVLPVTD
AAVLAANADGVIVVVSSGKTTFDMLQRAIASIQRTTGRVLGVVLNKVPRKGAESAYYGRE
YYGAYERYGRE
SITE-411/-413GKT
SITEWalker A'301/308ILIDCDLR
SITEWalker B381/387VILDSPP
SITEY Cluster449/461YYGREYYGAYERY
SITEWalker A281/283GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELSDYFRILRAHWIVILVATVLGAGAAFGWSALQPRVYAADTTGIVTAVGGDGSSGAALVGNQLAQSRVKSYLNLGSWR
MELSDYFRILRAHWIVILVATVLGAGAAFGWSALQPRVYAADTTGIVTAVGGDGSSGAALVGNQLAQSRVKSYLNLGSWR

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVAEHAIDDLGLEATPESLVSRVSVTNPTDTTALKVTATGATPETAQELAEAWMRGMAVEIEKLEGGTESSPAAVSLIVG
AVAEHAIDDLGLEATPESLVSRVSVTNPTDTTALKVTATGATPETAQELAEAWMRG                        

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSARLPTAPSSPNTRLNLIIGALAGLAIGLVYAFVRHTVDRRIRHPRDIERETGVSVIGTLPLEKTMDGERQVIDFSLDT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHGVSHHTIESMRELRTNLQFIDVDNPPRVIVVTSSVPGDGKSTVAVNLASSLAAAGQWAILIDCDLRRPVIADIFGISR
                                 TSSVPGDGKSTVAVNLASSLAAAGQWAILIDCDLRRPVIADIFGISR
                                        GKS                 ILIDCDLR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVGLTDILAGRAELQDVAHRPNRDVPLAVLGAGRIPPNPSELLGSHRMQDFLAEISKTAIVILDSPPVLPVTDAAVLAAN
DVGLTDILAGRAELQDVAHRPNRDVPLAVLGAGRIPPNPSELLGSHRMQDFLAEISKTAIVILDSPPVLPVTDAAVLAAN
                                                            VILDSPP             
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADGVIVVVSSGKTTFDMLQRAIASIQRTTGRVLGVVLNKVPRKGAESAYYGREYYGAYERYGRETEADDAAKADAEPGVR
ADGVIVVVSSGKTTFDMLQRAIASIQRTTGRVLGVVLNKVPRKGAESAYYGREYYGAYERYGRE                
                                                YYGREYYGAYERY                   
      
....:.
RRGRQA


© 1998-2019