BYKdb

Annotate results for A0A0F0LD75

A0A0F0LD75 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F0LD75
DOMAINtad1/140MDLREYLRVFRAHWLGMVLITLLGVAVAFGWTLLQPKVYTADASAIVQANTAGDAGDSNL
SSAMLGNSLTSGRVKTYVALGQSRAVADGVIKDLGLDVSADQLVKQVTVTNTVDTTTLKV
TADAATPEKARDVAEAWVRS
DOMAINcd282/471TSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMIDTVFGLPRGAGISDVLAGRAT
IAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMRELLKSIAREAIVIIDAPPLIPVTDA
AVLAHSADGAVIVGTIGKTTFEVLGKAIGNLERAGARALGLVLNRVPKRGSGAAYYGYQY
HGEYYRGDDQ
SITE-418/-420GKT
SITEWalker A'309/316VLIDGDLR
SITEWalker B388/394VIIDAPP
SITEY Cluster456/466YYGYQYHGEYY
SITEWalker A289/291GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDLREYLRVFRAHWLGMVLITLLGVAVAFGWTLLQPKVYTADASAIVQANTAGDAGDSNLSSAMLGNSLTSGRVKTYVAL
MDLREYLRVFRAHWLGMVLITLLGVAVAFGWTLLQPKVYTADASAIVQANTAGDAGDSNLSSAMLGNSLTSGRVKTYVAL

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQSRAVADGVIKDLGLDVSADQLVKQVTVTNTVDTTTLKVTADAATPEKARDVAEAWVRSMGAEVNRLETSDPGKKGAVF
GQSRAVADGVIKDLGLDVSADQLVKQVTVTNTVDTTTLKVTADAATPEKARDVAEAWVRS                    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSPIDSARLPDSPSSPNTRLALALGGLVGLAIAVGYGLLRYTLDRRIRSVEQVERETGKPVVGTIPEEKTFTADNRLLPF


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGGTSSSSESAHLFGIGEAMRELRTNLQYMDVDNPPRIIVVTSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMI
                                         TSPLPGDGKSTISSNLAVTLASSGQPVVLIDGDLRRPMI
                                                GKS                 VLIDGDLR    
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTVFGLPRGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMRELLKSIAREAIVIIDAPPLIPVTD
DTVFGLPRGAGISDVLAGRATIAEVAQRFGNGQLLVVTAGKVPPNPSEVLGSARMRELLKSIAREAIVIIDAPPLIPVTD
                                                                   VIIDAPP      
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AAVLAHSADGAVIVGTIGKTTFEVLGKAIGNLERAGARALGLVLNRVPKRGSGAAYYGYQYHGEYYRGDDQELPTGAVRG
AAVLAHSADGAVIVGTIGKTTFEVLGKAIGNLERAGARALGLVLNRVPKRGSGAAYYGYQYHGEYYRGDDQ         
                                                       YYGYQYHGEYY              
       490  
....:....|..
DKPRRRGDAEAA


© 1998-2019