BYKdb

Annotate results for A0A0F0LP73

A0A0F0LP73 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F0LP73
DOMAINcd270/459TSANLGEGKSSTTRTLARVLAESGQRTLVIDGDLRRPTVAEGFDLDGTVGLSEVLSGQMP
IGPAIRQTSDPNLFVLPAGGIPPNPSEMLGSTAFQRLLGELRRDFFIVIDAPPVLPVTDA
SVMSAFVDGVVFVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVAMRNSANGYGYYRK
NSHYYAQTSR
SITEWalker A277/279GKS
SITEWalker A'297/304LVIDGDLR
SITEWalker B376/382IVIDAPP
SITEY Cluster444/454YGYYRKNSHYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTVLDFLVLIRRGWFFLALGLLFGALGGFVTAQLTPPVYTAQATGFIAGTGGAVIAGTNIAIDRAGAYMPLVDTAQVREE


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAKDAKVPLSKLNGSLSAQVVPGSTMVRVTANAPDPQSALRLANGALHALANVVARIEDAAGAGATPPPGSTVVPTEGIV


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVPLDQAVAPRTPSAPDKRAMIIAGALIGLGVGLLLVLLRRALDVRVRAHTDVAAIVGAGVLGRVPKFDPDGRSKKDAIA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAVAHEAHRQIRTGLRFASVDQEVRVVMVTSANLGEGKSSTTRTLARVLAESGQRTLVIDGDLRRPTVAEGFDLDGTVGL
                             TSANLGEGKSSTTRTLARVLAESGQRTLVIDGDLRRPTVAEGFDLDGTVGL
                                    GKS                 LVIDGDLR                
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SEVLSGQMPIGPAIRQTSDPNLFVLPAGGIPPNPSEMLGSTAFQRLLGELRRDFFIVIDAPPVLPVTDASVMSAFVDGVV
SEVLSGQMPIGPAIRQTSDPNLFVLPAGGIPPNPSEMLGSTAFQRLLGELRRDFFIVIDAPPVLPVTDASVMSAFVDGVV
                                                       IVIDAPP                  
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVAMRNSANGYGYYRKNSHYYAQTSRNDDAAGDDEVAALISEAELSP
FVIAMGRTRKTEVVEARTQLAQIRARILGVVLNFVAMRNSANGYGYYRKNSHYYAQTSR                     
                                           YGYYRKNSHYY                          
       490       500       510       520       530       540       550     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
AAFDGEPPAPEESGAEDEGASRERRASRSRTVSDDAASSRATHARPRIAQTGQRSTPVRARRAKDANDLDPDATA


© 1998-2019