BYKdb

Annotate results for A0A0F0T3Y9

A0A0F0T3Y9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F0T3Y9
DOMAINcd3/187SGTSPGVGKSFVSSNLAVLMAQAGSRVLLIDCDLRRGYLHSIFSQAEGHAGLADYLSANV
AVSQVIEETEYQGVDFIGRGRMVNNPAELFMTEKFQTLVDACSAQYDVILLDTPPILSVT
DAAIIGRFASTSLMVVRFEQNSVQEVEAGLRRFNQNGIAIQGVIFNGVEKRASATYSYGD
YSYQE
SITEWalker A10/12GKS
SITEWalker A'30/37LLIDCDLR
SITEWalker B111/117ILLDTPP
SITEY Cluster178/185YSYGDYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MISGTSPGVGKSFVSSNLAVLMAQAGSRVLLIDCDLRRGYLHSIFSQAEGHAGLADYLSANVAVSQVIEETEYQGVDFIG
  SGTSPGVGKSFVSSNLAVLMAQAGSRVLLIDCDLRRGYLHSIFSQAEGHAGLADYLSANVAVSQVIEETEYQGVDFIG
         GKS                 LLIDCDLR                                           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RGRMVNNPAELFMTEKFQTLVDACSAQYDVILLDTPPILSVTDAAIIGRFASTSLMVVRFEQNSVQEVEAGLRRFNQNGI
RGRMVNNPAELFMTEKFQTLVDACSAQYDVILLDTPPILSVTDAAIIGRFASTSLMVVRFEQNSVQEVEAGLRRFNQNGI
                              ILLDTPP                                           
       170       180       
....:....|....:....|....:..
AIQGVIFNGVEKRASATYSYGDYSYQE
AIQGVIFNGVEKRASATYSYGDYSYQE
                 YSYGDYSY  
© 1998-2019