BYKdb

Annotate results for A0A0F2CIN0

A0A0F2CIN0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2CIN0
DOMAINcd41/231SSTFPGEGKTTTSTNLALTFAKAGHKTLLIDADIRNSKMLGGVFKSGEKVSGLTEYLARN
TDLSQGLCETDEENLFVITSGQASPNPTALLQSERFTTMMSVLRRHYDYIIVDTPPIGMV
VDATLIAKVCDASLLVVSTNEVKRKMVQKSKMQLEQSSTPFLGVVLNKYNVQADKYGFYG
SYGHYGDNLSK
SITEWalker A48/50GKT
SITEWalker A'68/75LLIDADIR
SITEWalker B150/156IIVDTPP
SITE-147/-149YDY
SITEY Cluster216/225YGFYGSYGHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPILELAKKKKLSISRVEEYYNALRTNIQLSGEDIKVIAVSSTFPGEGKTTTSTNLALTFAKAGHKTLLIDADIRNSKML
                                        SSTFPGEGKTTTSTNLALTFAKAGHKTLLIDADIRNSKML
                                               GKT                 LLIDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGVFKSGEKVSGLTEYLARNTDLSQGLCETDEENLFVITSGQASPNPTALLQSERFTTMMSVLRRHYDYIIVDTPPIGMV
GGVFKSGEKVSGLTEYLARNTDLSQGLCETDEENLFVITSGQASPNPTALLQSERFTTMMSVLRRHYDYIIVDTPPIGMV
                                                                     IIVDTPP    
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
VDATLIAKVCDASLLVVSTNEVKRKMVQKSKMQLEQSSTPFLGVVLNKYNVQADKYGFYGSYGHYGDNLSKE
VDATLIAKVCDASLLVVSTNEVKRKMVQKSKMQLEQSSTPFLGVVLNKYNVQADKYGFYGSYGHYGDNLSK 
                                                       YGFYGSYGHY       
© 1998-2019