BYKdb

Annotate results for A0A0F2DFW5

A0A0F2DFW5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2DFW5
DOMAINcd39/217TSANPNEGKSEVSINLAASLAQQGKRVIIIDADMRKPTQHKLTELNNTEGLSTFLLKKSG
VDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMDETLKAFEDFYDYVIIDTPPLLAAT
DAQVLASISDATLLVVDIKKSKRRQIIEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
SITEWalker A46/48GKS
SITEWalker A'66/73IIIDADMR
SITEWalker B147/153VIIDTPP
SITE-144/-146YDY
SITEY Cluster213/217YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHIEVIHNSKSIVAESFRTLRSNLQFSEFGKNIKIIVVTSANPNEGKSEVSINLAASLAQQGKRVIIIDADMRKPTQHKL
                                      TSANPNEGKSEVSINLAASLAQQGKRVIIIDADMRKPTQHKL
                                             GKS                 IIIDADMR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELNNTEGLSTFLLKKSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMDETLKAFEDFYDYVIIDTPPLLAATDA
TELNNTEGLSTFLLKKSGVDSINHLTINDVNLDVLTSGPVPPNPSEMLASSSMDETLKAFEDFYDYVIIDTPPLLAATDA
                                                                  VIIDTPP       
       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
QVLASISDATLLVVDIKKSKRRQIIEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
QVLASISDATLLVVDIKKSKRRQIIEAKRRLDHVGARLLGVIMNKIDSHKDTYYYYY
                                                    YYYYY
© 1998-2019