BYKdb

Annotate results for A0A0F2DXP0

A0A0F2DXP0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2DXP0
DOMAINcd41/230SSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMSGVFKSREKITGLTDFLAGTT
DLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
DAAIITQKCDASILVTAAGETKRRDVIKAKEQLEQTGVPFLGVVLNKFNTEVEKYGAYGG
YGAYGAYGSY
SITEWalker A48/50GKS
SITEWalker A'68/75LLVDADIR
SITEWalker B149/155VIVDTAP
SITE-145/-148YFDY
SITEY Cluster215/233YGAYGGYGAYGAYGSYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPILEIGQKRLDFAKKAEEHYNALRTNIQLSGDNLKVLAISSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
                                        SSVKPGEGKSTTSTNIAWAFARAGYKTLLVDADIRNSVMS
                                               GKS                 LLVDADIR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
GVFKSREKITGLTDFLAGTTDLSHGLCDTNVENLFVIQAGPVSPNPTALLQSENFHTMIDTLRKYFDYVIVDTAPIGMVI
                                                                    VIVDTAP     
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAAIITQKCDASILVTAAGETKRRDVIKAKEQLEQTGVPFLGVVLNKFNTEVEKYGAYGGYGAYGAYGSYGNYGKKK
DAAIITQKCDASILVTAAGETKRRDVIKAKEQLEQTGVPFLGVVLNKFNTEVEKYGAYGGYGAYGAYGSY       
                                                      YGAYGGYGAYGAYGSYGNY    
© 1998-2019