BYKdb

Annotate results for A0A0F2J1D3

A0A0F2J1D3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2J1D3
DOMAINcd191/376TSSIEKEGKSSIASNLAVTFSAEDKNVLLLDLDLRRPSAHTFFNKTSAKGITNVLADTMT
LDEAIEKTDIKGLDLLLSGPIPPDPSRLIESEKIKNIIEALKQKYSLIIIDTPPVVSVND
AVVIGKLVDGAVYVVEAGRASGSMVNHFVDAASKANINIFGLILNKFRPHASNYYHYYQH
YRYYKK
SITEWalker A198/200GKS
SITEWalker A'218/225LLLDLDLR
SITEWalker B298/304IIIDTPP
SITEY Cluster364/374YYHYYQHYRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MELAKRIVIDAITIEVYKEKTKILKNYLSKYKEELIKLPAISEDNAKVNLELSVNKDIYQKLLEYILQIEIAESMTMSDR


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ILVEPAELPEEQKYPWNKLNYILGFILAVFWAFTVALFLEYIDDTIKDPDELKQTSKQPLLGSIPKTKVFKDIKNISNLP


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PTSPFVEAYRTIRNSLLFASIDKPVKTFLVTSSIEKEGKSSIASNLAVTFSAEDKNVLLLDLDLRRPSAHTFFNKTSAKG
                              TSSIEKEGKSSIASNLAVTFSAEDKNVLLLDLDLRRPSAHTFFNKTSAKG
                                     GKS                 LLLDLDLR               
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ITNVLADTMTLDEAIEKTDIKGLDLLLSGPIPPDPSRLIESEKIKNIIEALKQKYSLIIIDTPPVVSVNDAVVIGKLVDG
ITNVLADTMTLDEAIEKTDIKGLDLLLSGPIPPDPSRLIESEKIKNIIEALKQKYSLIIIDTPPVVSVNDAVVIGKLVDG
                                                         IIIDTPP                
       330       340       350       360       370      
....:....|....:....|....:....|....:....|....:....|....:.
AVYVVEAGRASGSMVNHFVDAASKANINIFGLILNKFRPHASNYYHYYQHYRYYKK
AVYVVEAGRASGSMVNHFVDAASKANINIFGLILNKFRPHASNYYHYYQHYRYYKK
                                           YYHYYQHYRYY  
© 1998-2019