BYKdb

Annotate results for A0A0F2JBL3

A0A0F2JBL3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2JBL3
DOMAINcd3/191TSAGPREGKSTTVANLAVSMAQSGKSVLVLDADLRNPTQHKLFGLDNREGLSVALVQEQD
YRSYIRETAVSGVMVLTGGPIPPNPAELVGSKRMKRLLEEVSEQFDIILIDTPPIVAVTD
PAILAQDVDGVILVMASGEVHKDYAQSAKELLDKVGAKILGVVLNKADMKTSDYYYYYYY
YHGSDNPKK
SITEWalker A10/12GKS
SITEWalker A'30/37LVLDADLR
SITEWalker B110/116ILIDTPP
SITE-63/-66YRSY
SITE-26/-28GKS
SITEY Cluster176/183YYYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MITSAGPREGKSTTVANLAVSMAQSGKSVLVLDADLRNPTQHKLFGLDNREGLSVALVQEQDYRSYIRETAVSGVMVLTG
  TSAGPREGKSTTVANLAVSMAQSGKSVLVLDADLRNPTQHKLFGLDNREGLSVALVQEQDYRSYIRETAVSGVMVLTG
         GKS                 LVLDADLR                                           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPIPPNPAELVGSKRMKRLLEEVSEQFDIILIDTPPIVAVTDPAILAQDVDGVILVMASGEVHKDYAQSAKELLDKVGAK
GPIPPNPAELVGSKRMKRLLEEVSEQFDIILIDTPPIVAVTDPAILAQDVDGVILVMASGEVHKDYAQSAKELLDKVGAK
                             ILIDTPP                                            
       170       180       190         
....:....|....:....|....:....|....:....
ILGVVLNKADMKTSDYYYYYYYYHGSDNPKKKPKRHKNR
ILGVVLNKADMKTSDYYYYYYYYHGSDNPKK        
               YYYYYYYY                
© 1998-2019