BYKdb

Annotate results for A0A0F2N5U0

A0A0F2N5U0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2N5U0
DOMAINcd58/245TSPTLGDGKSTITANLGMVMAQAGKKVLVMDADLRKPMQHHIFSVSNLRGLTNILVQGEP
LAEVAHEVSANGLFFVPSGPIPPNPSELLASNRMLKLLEEAQKDYDIVLIDSPPMIAVTD
SSILSTRMDGVMLVVRAGVTRVDLINDAIGQLKKASANFIGLVLNQVRVPSHDYQYYYYY
GHKNKEAE
SITEWalker A65/67GKS
SITEWalker A'85/92LVMDADLR
SITEWalker B165/171VLIDSPP
SITEY Cluster231/237YQYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLKKNGGIKFFDTDQKNELRELYALDNPKAPVVEAFRTLRTNVSFASVDKTFKTLLITSPTLGDGKSTITANLGMVMAQA
                                                         TSPTLGDGKSTITANLGMVMAQA
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKKVLVMDADLRKPMQHHIFSVSNLRGLTNILVQGEPLAEVAHEVSANGLFFVPSGPIPPNPSELLASNRMLKLLEEAQK
GKKVLVMDADLRKPMQHHIFSVSNLRGLTNILVQGEPLAEVAHEVSANGLFFVPSGPIPPNPSELLASNRMLKLLEEAQK
    LVMDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DYDIVLIDSPPMIAVTDSSILSTRMDGVMLVVRAGVTRVDLINDAIGQLKKASANFIGLVLNQVRVPSHDYQYYYYYGHK
DYDIVLIDSPPMIAVTDSSILSTRMDGVMLVVRAGVTRVDLINDAIGQLKKASANFIGLVLNQVRVPSHDYQYYYYYGHK
    VLIDSPP                                                           YQYYYYY   
        
....:...
NKEAEMRF
NKEAE   

© 1998-2019