BYKdb

Annotate results for A0A0F2NF69

A0A0F2NF69 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2NF69
DOMAINcd59/248TSAIPREGKSFVTANLGISLAHGLDQHSLLVDCDLRKPVLAKMFGLDNSVGLVDYLRDDV
MLSKLIANTAVKTLSVLTSGKSPANPAELLGSARMPALVEELSDRYEDRLIIFDSPPLLV
AAESSVLAGQVDAIILVVRQGTSGKAQIQKLIDIIGDERILGIVFNDQNLSSFQQKLGMG
CGSYYGGYYH
SITE-138/-140GKS
SITEWalker A'87/94LLVDCDLR
SITEWalker B169/175IIFDSPP
SITEY Cluster242/247YYGGYY
SITEWalker A66/68GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MESFNEQHRLAKSLSGKWDERLFKAANDDGYLPEVFKTLRSRILHPLDGGKIPKTIMVTSAIPREGKSFVTANLGISLAH
                                                          TSAIPREGKSFVTANLGISLAH
                                                                 GKS            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLDQHSLLVDCDLRKPVLAKMFGLDNSVGLVDYLRDDVMLSKLIANTAVKTLSVLTSGKSPANPAELLGSARMPALVEEL
GLDQHSLLVDCDLRKPVLAKMFGLDNSVGLVDYLRDDVMLSKLIANTAVKTLSVLTSGKSPANPAELLGSARMPALVEEL
      LLVDCDLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SDRYEDRLIIFDSPPLLVAAESSVLAGQVDAIILVVRQGTSGKAQIQKLIDIIGDERILGIVFNDQNLSSFQQKLGMGCG
SDRYEDRLIIFDSPPLLVAAESSVLAGQVDAIILVVRQGTSGKAQIQKLIDIIGDERILGIVFNDQNLSSFQQKLGMGCG
        IIFDSPP                                                                 
         
....:....
SYYGGYYHQ
SYYGGYYH 
 YYGGYY  
© 1998-2019