BYKdb

Annotate results for A0A0F2P7X6

A0A0F2P7X6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F2P7X6
DOMAINtad16/154NEISLGEIISALFKWWWLVVLCTVLAALGAYFYTISTYVPVYTASASMVVNSKQLKIVGQ
EAVLTNDVNLSAKLVNTYTAVLTSNRVMELVAGELDLPASAISPYVSVAPVRDTEVLRIF
VSNPDPLLAAKICNSIMHV
DOMAINcd293/484TSILTGEGKSTVAVNLAITIARTGKSVLLVDCDLRKSNMHGVLELDLEDHQGLAAVLNGA
CAAEEGIVFAAEQGIYVMPNGYIVPNPSELLGSEKMAALLAALEKQYDYIILDTPPSYLL
TDAVALSVYADGVILVVKQGCAKVDVINSAQAAFENAGVRIIGCILNGIKYNQLGAFYQS
QNYERFLGDYYK
SITEWalker A300/302GKS
SITEWalker A'320/327LLVDCDLR
SITEWalker B402/408IILDTPP
SITE-368/-401YVMPNGYIVPNPSELLGSEKMAALLAALEKQYDY
SITE-316/-318GKS
SITEY Cluster470/486YQSQNYERFLGDYYKDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEHQGLNNGVDRTEENEISLGEIISALFKWWWLVVLCTVLAALGAYFYTISTYVPVYTASASMVVNSKQLKIVGQEAVLT
               NEISLGEIISALFKWWWLVVLCTVLAALGAYFYTISTYVPVYTASASMVVNSKQLKIVGQEAVLT

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NDVNLSAKLVNTYTAVLTSNRVMELVAGELDLPASAISPYVSVAPVRDTEVLRIFVSNPDPLLAAKICNSIMHVAPTAIS
NDVNLSAKLVNTYTAVLTSNRVMELVAGELDLPASAISPYVSVAPVRDTEVLRIFVSNPDPLLAAKICNSIMHV      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
STVEVGSINVLDNAKVPEFPNAPATFRNVGVGAVLGLMLGLGIVFMLMFFDRTIKSGDDVKNKLGLTLLGSIPYLSPKAR


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGQGQSQGQGQGQGAPLVTSDQVGFGFVESYKAAGTNLRFASAVTSAKKLLVTSILTGEGKSTVAVNLAITIARTGKSVL
                                                    TSILTGEGKSTVAVNLAITIARTGKSVL
                                                           GKS                 L
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVDCDLRKSNMHGVLELDLEDHQGLAAVLNGACAAEEGIVFAAEQGIYVMPNGYIVPNPSELLGSEKMAALLAALEKQYD
LVDCDLRKSNMHGVLELDLEDHQGLAAVLNGACAAEEGIVFAAEQGIYVMPNGYIVPNPSELLGSEKMAALLAALEKQYD
LVDCDLR                                                                         
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YIILDTPPSYLLTDAVALSVYADGVILVVKQGCAKVDVINSAQAAFENAGVRIIGCILNGIKYNQLGAFYQSQNYERFLG
YIILDTPPSYLLTDAVALSVYADGVILVVKQGCAKVDVINSAQAAFENAGVRIIGCILNGIKYNQLGAFYQSQNYERFLG
 IILDTPP                                                             YQSQNYERFLG
       490       500   
....:....|....:....|...
DYYKDYALTNKPAQEAAAASDKN
DYYK                   
DYYKDY                 
© 1998-2019