BYKdb

Annotate results for A0A0F2PBH4

A0A0F2PBH4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2PBH4
DOMAINcd47/235TSALSGEGKSTVAANLGVVMAQAGKRVVIIDCDLRNPVMHKYFNIINNQGLSNLLSHDLV
LGDTIHTTGTEGPSLITSGPIPPNPSELLASQKMMDLLQHLSAHFDTVLIDTPPVIAVTD
AVVLATRVDGVLLVLKSESTALDKAKRAKQQLEMANAKIIGVVLNDVKIKRSDCNYYYYN
RDYKQAQRE
SITEWalker A54/56GKS
SITEWalker A'74/81VIIDCDLR
SITEWalker B154/160VLIDTPP
SITEY Cluster222/229YYYYNRDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRNSKNLSKMLFAQNNPMAPVSETFRTLRTNIYFSIEARSKGTILITSALSGEGKSTVAANLGVVMAQAGKRVVIIDCDL
                                              TSALSGEGKSTVAANLGVVMAQAGKRVVIIDCDL
                                                     GKS                 VIIDCDL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RNPVMHKYFNIINNQGLSNLLSHDLVLGDTIHTTGTEGPSLITSGPIPPNPSELLASQKMMDLLQHLSAHFDTVLIDTPP
RNPVMHKYFNIINNQGLSNLLSHDLVLGDTIHTTGTEGPSLITSGPIPPNPSELLASQKMMDLLQHLSAHFDTVLIDTPP
R                                                                        VLIDTPP
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VIAVTDAVVLATRVDGVLLVLKSESTALDKAKRAKQQLEMANAKIIGVVLNDVKIKRSDCNYYYYNRDYKQAQREADVLL
VIAVTDAVVLATRVDGVLLVLKSESTALDKAKRAKQQLEMANAKIIGVVLNDVKIKRSDCNYYYYNRDYKQAQRE     
                                                             YYYYNRDY           
       250 
....:....|.
KQAAATKDDNS


© 1998-2019