BYKdb

Annotate results for A0A0F2QB88

A0A0F2QB88 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2QB88
DOMAINcd37/218TSTGPAEGKSTIIANLAIVLAQTGKKVLLVDADLRRPTLHSIFDAGNLVGLSSCLEKKLS
LMEVVQKTKIENLYIITSGFFPLKPSELNSSKIDELFEDVEAYDYILFDTPPAGTFTDAL
VLSEKVDAVLVVINSKKVPIDLAQQTIEKLRNAKTEIIGVIFNNVQYEKDFYKNYYYYGD
KK
SITEWalker A44/46GKS
SITEWalker A'64/71LLVDADLR
SITEWalker B142/148ILFDTPP
SITE-139/-141YDY
SITEY Cluster203/214YEKDFYKNYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MITYSDPKSPEAEAFRTIRTNLYYYNLDHRFKKVMLTSTGPAEGKSTIIANLAIVLAQTGKKVLLVDADLRRPTLHSIFD
                                    TSTGPAEGKSTIIANLAIVLAQTGKKVLLVDADLRRPTLHSIFD
                                           GKS                 LLVDADLR         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGNLVGLSSCLEKKLSLMEVVQKTKIENLYIITSGFFPLKPSELNSSKIDELFEDVEAYDYILFDTPPAGTFTDALVLSE
AGNLVGLSSCLEKKLSLMEVVQKTKIENLYIITSGFFPLKPSELNSSKIDELFEDVEAYDYILFDTPPAGTFTDALVLSE
                                                             ILFDTPP            
       170       180       190       200       210        
....:....|....:....|....:....|....:....|....:....|....:...
KVDAVLVVINSKKVPIDLAQQTIEKLRNAKTEIIGVIFNNVQYEKDFYKNYYYYGDKK
KVDAVLVVINSKKVPIDLAQQTIEKLRNAKTEIIGVIFNNVQYEKDFYKNYYYYGDKK
                                          YEKDFYKNYYYY    
© 1998-2019