BYKdb

Annotate results for A0A0F2R2U0

A0A0F2R2U0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2R2U0
DOMAINcd92/276TSPLPSDGKSFISSNLAISIALGIEEYVLLVDCDVRRPTIHSYFGFGKVTGLSEHLSMGI
DLSKTLLKSPIPKLTILPAGHPPGNPTELLTSKRMKTLLEEVANRYDDRYILIDSPPPSM
AAETNAMINIVDGVILVVKAGVTPKNAVNETIEQIGKEKLLGVVLNYADQSVKKYYGYGR
SYYHG
SITEWalker A99/101GKS
SITEWalker A'120/127LLVDCDVR
SITEWalker B202/208ILIDSPP
SITE-197/-201YDDRY
SITEY Cluster266/274YYGYGRSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGKIFDALEKSNTQAAKSVPLPHVRTDIVNGKGADRIVPISNSNKLTSEHKLDVNLITYHAPQSVEAELFKVLRTNLLFP


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PKGQPPRKILVTSPLPSDGKSFISSNLAISIALGIEEYVLLVDCDVRRPTIHSYFGFGKVTGLSEHLSMGIDLSKTLLKS
           TSPLPSDGKSFISSNLAISIALGIEEYVLLVDCDVRRPTIHSYFGFGKVTGLSEHLSMGIDLSKTLLKS
                  GKS                  LLVDCDVR                                 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PIPKLTILPAGHPPGNPTELLTSKRMKTLLEEVANRYDDRYILIDSPPPSMAAETNAMINIVDGVILVVKAGVTPKNAVN
PIPKLTILPAGHPPGNPTELLTSKRMKTLLEEVANRYDDRYILIDSPPPSMAAETNAMINIVDGVILVVKAGVTPKNAVN
                                         ILIDSPP                                
       250       260       270      
....:....|....:....|....:....|....:.
ETIEQIGKEKLLGVVLNYADQSVKKYYGYGRSYYHG
ETIEQIGKEKLLGVVLNYADQSVKKYYGYGRSYYHG
                         YYGYGRSYY  
© 1998-2019