BYKdb

Annotate results for A0A0F2S779

A0A0F2S779 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F2S779
DOMAINcd41/229TSSGPREGKSHTVANLGVSMAQSGKSVLIIDADLRNPTQHKLFGLDNGEGLSVSLVQDQD
YHKYIRETTVPGVMVLPAGPVPPNPAELVGSKRMKRLIEEVSEQFDMVLIDTPPIIAVTD
AAILAQEVDGVILVLASGEVNKGYAQKAKEQLDKLGVKILGAVLNKVDLNTNEYYHYYYY
NASDDTEKK
SITEWalker A48/50GKS
SITEWalker A'68/75LIIDADLR
SITEWalker B148/154VLIDTPP
SITE-101/-104YHKY
SITE-64/-66GKS
SITEY Cluster214/220YYHYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAYSLITLEQTKSPISEAYRALRTNVQFTRVDSESQKIMVTSSGPREGKSHTVANLGVSMAQSGKSVLIIDADLRNPTQH
                                        TSSGPREGKSHTVANLGVSMAQSGKSVLIIDADLRNPTQH
                                               GKS                 LIIDADLR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KLFGLDNGEGLSVSLVQDQDYHKYIRETTVPGVMVLPAGPVPPNPAELVGSKRMKRLIEEVSEQFDMVLIDTPPIIAVTD
KLFGLDNGEGLSVSLVQDQDYHKYIRETTVPGVMVLPAGPVPPNPAELVGSKRMKRLIEEVSEQFDMVLIDTPPIIAVTD
                                                                   VLIDTPP      
       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
AAILAQEVDGVILVLASGEVNKGYAQKAKEQLDKLGVKILGAVLNKVDLNTNEYYHYYYYNASDDTEKKHNRHKAR
AAILAQEVDGVILVLASGEVNKGYAQKAKEQLDKLGVKILGAVLNKVDLNTNEYYHYYYYNASDDTEKK       
                                                     YYHYYYY                
© 1998-2019