BYKdb

Annotate results for A0A0F3LM14

A0A0F3LM14 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F3LM14
DOMAINtad24/196GLIDLRRLWHILLKRWWILAGVLAVALVLGVVITLLSTPIYRASATLQIDREAAQVVDVE
GVLPAEGMYSAQEFYQTQYGLLKSRSLAQRVVTGLRLAQDAQFIEANRRSPANAQPRSDE
DGGSPAERNRQAVSQLLANLRVTPTMNSRLVTISYDSADPALAQAVVNSITET
DOMAINcd542/729TSAQPAEGKSTSSVAIARAFARMGKSVLLIDGDLRNPSLHKMLGGNNRAGFSSALAGSDL
NDLLQPTEQEHLTLLPSGPRPPSPADLLSSQALPDVLGRLAEHFDLVIIDGPPVMGLADA
TLLGNASEGVLFISGAGIVRRGTALRALDRLRGAGADILGGVLERFDSKRANLGGYGYEY
TYAYDYGM
SITE-565/-567GKS
SITEWalker A'569/576LLIDGDLR
SITEWalker B648/654VIIDGPP
SITEY Cluster717/727YGYEYTYAYDY
SITEWalker A549/551GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLPAAGTSSSAAESRPLFGQDGDGLIDLRRLWHILLKRWWILAGVLAVALVLGVVITLLSTPIYRASATLQIDREAAQVV
                       GLIDLRRLWHILLKRWWILAGVLAVALVLGVVITLLSTPIYRASATLQIDREAAQVV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVEGVLPAEGMYSAQEFYQTQYGLLKSRSLAQRVVTGLRLAQDAQFIEANRRSPANAQPRSDEDGGSPAERNRQAVSQLL
DVEGVLPAEGMYSAQEFYQTQYGLLKSRSLAQRVVTGLRLAQDAQFIEANRRSPANAQPRSDEDGGSPAERNRQAVSQLL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANLRVTPTMNSRLVTISYDSADPALAQAVVNSITETFIATNLERRFEASSYARRFLEERIEQLRARLEESERELVAYASN
ANLRVTPTMNSRLVTISYDSADPALAQAVVNSITET                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQIINIPSASATSDGNANRGRSLIASSLEALNASLAEARTTRIEAEERSRAAQASTGLGLSEVLSSPTIQALREQRAELT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ARRQELLERFQPEYPSVQQIQAQITELDRQLAAEAGDVRRSLQGQYASAAAAERSIQGEIDALKAQALDLDQRSIRYNIL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRELDTNRTLYDGLLQRYREIGIAGGVGTNNVSIVDRADLPVNPVAPRPLINLALAGLLGLLLGAAIIFVLEFLDESLRV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PADVEAKLNLPLLGSVPWLPSAAALAQAERDPRSGFSEAYHSVRSALQFARPGGMVRTLLVTSAQPAEGKSTSSVAIARA
                                                             TSAQPAEGKSTSSVAIARA
                                                                    GKS         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FARMGKSVLLIDGDLRNPSLHKMLGGNNRAGFSSALAGSDLNDLLQPTEQEHLTLLPSGPRPPSPADLLSSQALPDVLGR
FARMGKSVLLIDGDLRNPSLHKMLGGNNRAGFSSALAGSDLNDLLQPTEQEHLTLLPSGPRPPSPADLLSSQALPDVLGR
        LLIDGDLR                                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAEHFDLVIIDGPPVMGLADATLLGNASEGVLFISGAGIVRRGTALRALDRLRGAGADILGGVLERFDSKRANLGGYGYE
LAEHFDLVIIDGPPVMGLADATLLGNASEGVLFISGAGIVRRGTALRALDRLRGAGADILGGVLERFDSKRANLGGYGYE
       VIIDGPP                                                              YGYE
       730       740  
....:....|....:....|..
YTYAYDYGMEETPGAKARRRKR
YTYAYDYGM             
YTYAYDY               

© 1998-2019