BYKdb

Annotate results for A0A0F4LRK2

A0A0F4LRK2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F4LRK2
DOMAINcd57/237TSSGPSEGKSLTAANLAIVFAKSGKKTLLLDGDMRKPTVWKTFRLSNQKGLSTLLVSPDD
IADSIQKTTIDNLSVLTSGPQPPNPSELLGSTREEVIMDQLTRLFDVIIVDMPPVVTVTD
AQIVASKADGTILVAREGVSEKAALLKAKQLLEIAHARILGVVYNGVDSANDAGYYYYSD
K
SITEWalker A64/66GKS
SITEWalker A'84/91LLLDGDMR
SITEWalker B164/170IIVDMPP
SITEY Cluster231/234YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKKKSKTQLASQKTAAVSLISLLNSRSTIAEQYRTIRTNIQFAASSDHPVKSIVITSSGPSEGKSLTAANLAIVFAKSG
                                                        TSSGPSEGKSLTAANLAIVFAKSG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKTLLLDGDMRKPTVWKTFRLSNQKGLSTLLVSPDDIADSIQKTTIDNLSVLTSGPQPPNPSELLGSTREEVIMDQLTRL
KKTLLLDGDMRKPTVWKTFRLSNQKGLSTLLVSPDDIADSIQKTTIDNLSVLTSGPQPPNPSELLGSTREEVIMDQLTRL
   LLLDGDMR                                                                     
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
FDVIIVDMPPVVTVTDAQIVASKADGTILVAREGVSEKAALLKAKQLLEIAHARILGVVYNGVDSANDAGYYYYSDK
FDVIIVDMPPVVTVTDAQIVASKADGTILVAREGVSEKAALLKAKQLLEIAHARILGVVYNGVDSANDAGYYYYSDK
   IIVDMPP                                                            YYYY   
© 1998-2019