BYKdb

Annotate results for A0A0F4QLY7

A0A0F4QLY7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F4QLY7
DOMAINtad14/288EDIDLGRILGLLLRHKWWILAVTLLFGAAGYVSALLKPPIYEGDALVHVERRASVSPLGD
LATVMGEEENTSAEVQILRSRMVLGRVVDRLALDTQVSPRRLPLVGDYLVREGVTREDLA
ELGWMTAPLGWLERLMPEAWDLSHLVWAGESLQLARLEVADSYRGAAFRLVAGRDAGYQL
FGPDGDLLGVGRVGDTARFDGGDVVLSVREMTAAPGAEYSLSKRPQVSAIDSLLARLTVT
EQGSGSSASTGMLRLTLTGTDIDRVRESLDVLAET
DOMAINcd570/754TGPSPEIGKSFISLNLGVICAQAGQRVLVIDADMRKGHLHSAFGAKAESGLSDLLSDKSE
VAEVIRQTEVEGLDYLSRGACPPNPSELLMRERFTTLMEQFSRDYDLVIVDTPPVLAVTD
AAIVGNRVGTSLLVTRFKLNPVKEVRVALRRLETSNVRVKGCILNAMDPSARHGYGYGHY
VYAYQ
SITEWalker A577/579GKS
SITEWalker A'597/604LVIDADMR
SITEWalker B677/683VIVDTPP
SITEY Cluster744/753YGYGHYVYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTQMSRLPSAPGREDIDLGRILGLLLRHKWWILAVTLLFGAAGYVSALLKPPIYEGDALVHVERRASVSPLGDLATVMGE
             EDIDLGRILGLLLRHKWWILAVTLLFGAAGYVSALLKPPIYEGDALVHVERRASVSPLGDLATVMGE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EENTSAEVQILRSRMVLGRVVDRLALDTQVSPRRLPLVGDYLVREGVTREDLAELGWMTAPLGWLERLMPEAWDLSHLVW
EENTSAEVQILRSRMVLGRVVDRLALDTQVSPRRLPLVGDYLVREGVTREDLAELGWMTAPLGWLERLMPEAWDLSHLVW

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGESLQLARLEVADSYRGAAFRLVAGRDAGYQLFGPDGDLLGVGRVGDTARFDGGDVVLSVREMTAAPGAEYSLSKRPQV
AGESLQLARLEVADSYRGAAFRLVAGRDAGYQLFGPDGDLLGVGRVGDTARFDGGDVVLSVREMTAAPGAEYSLSKRPQV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAIDSLLARLTVTEQGSGSSASTGMLRLTLTGTDIDRVRESLDVLAETFLMQNVERQSAQADQSLAFLDEQAVALKASLS
SAIDSLLARLTVTEQGSGSSASTGMLRLTLTGTDIDRVRESLDVLAET                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SAEDRLNAYRVEVDSIDLDSEAASVVEQLISVEEQLNTLDFQEAELVQRFTRNHPTYQALMRQRGILNQEKARLEERVSE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPESQQEIVRLTRDVEVTQAIYVNVLNRAQEVAVAKAGTIGNVRVIDDAYVDDDPVAPNAGLMMALATVIGAFLAVAVVL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRGMLNRGIESPDQLEDLGLPVYATVPLSEFQQRLVKRVKYRSDRRSQPVIKGLLALTQPTDMAIEALRGLRTSLHFAMM


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAPNNCLMITGPSPEIGKSFISLNLGVICAQAGQRVLVIDADMRKGHLHSAFGAKAESGLSDLLSDKSEVAEVIRQTEVE
         TGPSPEIGKSFISLNLGVICAQAGQRVLVIDADMRKGHLHSAFGAKAESGLSDLLSDKSEVAEVIRQTEVE
                GKS                 LVIDADMR                                    
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLDYLSRGACPPNPSELLMRERFTTLMEQFSRDYDLVIVDTPPVLAVTDAAIVGNRVGTSLLVTRFKLNPVKEVRVALRR
GLDYLSRGACPPNPSELLMRERFTTLMEQFSRDYDLVIVDTPPVLAVTDAAIVGNRVGTSLLVTRFKLNPVKEVRVALRR
                                    VIVDTPP                                     
       730       740       750    
....:....|....:....|....:....|....
LETSNVRVKGCILNAMDPSARHGYGYGHYVYAYQ
LETSNVRVKGCILNAMDPSARHGYGYGHYVYAYQ
                       YGYGHYVYAY 

© 1998-2019