BYKdb

Annotate results for A0A0F4WIN2

A0A0F4WIN2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F4WIN2
DOMAINcd38/215TSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFFNISNSAGITDILLGEEK
LEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDA
QIISASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
SITEWalker A45/47GKS
SITEWalker A'65/72IILDCDFR
SITEWalker B144/150VIIDSPP
SITEY Cluster210/214YSDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIVESRPKSAEAEAYKTLRTNVQYSSISKKIKTLLVTSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
                                     TSADSKDGKSTVCSNLGVTFSQNGQSVIILDCDFRKPSIHKFF
                                            GKS                 IILDCDFR        
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
NISNSAGITDILLGEEKLEETIQHYNSNTDILTAGNIPPNPSEILGSQSMINLLSFLSERYDIVIIDSPPVGVVTDAQII
                                                               VIIDSPP          
       170       180       190       200       210     
....:....|....:....|....:....|....:....|....:....|....:
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
SASVDGTLVVIRAEETKAKRVTEAVNLLKKVDANIIGMVLNEAQTINKSYSDYYA
                                                 YSDYY 
© 1998-2019