BYKdb

Annotate results for A0A0F5FT46

A0A0F5FT46 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F5FT46
DOMAINtad4/176SEIDIRGILGFLRRRLRLIALTFLVVVGAAGIVAFTLTPIYSAAALILVDPSHKNLLQPE
AQLNATSADNARIDSEVEILRSDSILLKVIASQNLLLNEEFGASAGLRTRLMNLLRLGEP
PRPSEEDILNATLGKLRDAFSVQRRGMTYLIAVQARSQDPEMAARLANAIAGA
DOMAINcd421/612SSTAPGEGKSTLSLALARSYALSGRRTLLIDCDLRKPSIHRQLGIEPSHGLHDYLSPSGS
GPMDLISVVSRDQLTDATVIVGARKSDVPTDQLLAGASFGKLIEAARSSFEIIILDTPPI
DPIVDGLYVAPFADSIVFVTKWASTAQNDTRKAIESLTQAKRPETPIVTALNQQDEPKTA
YYRKYGGYYQEA
SITEWalker A428/430GKS
SITEWalker A'448/455LLIDCDLR
SITEWalker B533/539IILDTPP
SITEY Cluster601/609YYRKYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDDSEIDIRGILGFLRRRLRLIALTFLVVVGAAGIVAFTLTPIYSAAALILVDPSHKNLLQPEAQLNATSADNARIDSEV
   SEIDIRGILGFLRRRLRLIALTFLVVVGAAGIVAFTLTPIYSAAALILVDPSHKNLLQPEAQLNATSADNARIDSEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EILRSDSILLKVIASQNLLLNEEFGASAGLRTRLMNLLRLGEPPRPSEEDILNATLGKLRDAFSVQRRGMTYLIAVQARS
EILRSDSILLKVIASQNLLLNEEFGASAGLRTRLMNLLRLGEPPRPSEEDILNATLGKLRDAFSVQRRGMTYLIAVQARS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDPEMAARLANAIAGAYIEDQLSAKIASTQASRDILQSRIIEARDAIAASKGALDAFVETHIQPVPEARREAIEPQLPGL
QDPEMAARLANAIAGA                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EETSPTALDLRRDVLGSALPAGTLAELYALQQNAEIARSQYQQLLSRSRNLEAQINLQIADSRIVSPALAPQLPSFPNKT


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LILALAALGALGFGVALAFLYENLIGGFTTEAQMESVLRFRVASAVPRAKPQPEGGPSDLMVNAPLSAFAEAIRRIRTVV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQQARAGAAPAGEGGRVIMVSSTAPGEGKSTLSLALARSYALSGRRTLLIDCDLRKPSIHRQLGIEPSHGLHDYLSPSGS
                    SSTAPGEGKSTLSLALARSYALSGRRTLLIDCDLRKPSIHRQLGIEPSHGLHDYLSPSGS
                           GKS                 LLIDCDLR                         
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GPMDLISVVSRDQLTDATVIVGARKSDVPTDQLLAGASFGKLIEAARSSFEIIILDTPPIDPIVDGLYVAPFADSIVFVT
GPMDLISVVSRDQLTDATVIVGARKSDVPTDQLLAGASFGKLIEAARSSFEIIILDTPPIDPIVDGLYVAPFADSIVFVT
                                                    IILDTPP                     
       570       580       590       600       610  
....:....|....:....|....:....|....:....|....:....|..
KWASTAQNDTRKAIESLTQAKRPETPIVTALNQQDEPKTAYYRKYGGYYQEA
KWASTAQNDTRKAIESLTQAKRPETPIVTALNQQDEPKTAYYRKYGGYYQEA
                                        YYRKYGGYY   
© 1998-2019