BYKdb

Annotate results for A0A0F5IT40

A0A0F5IT40 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F5IT40
DOMAINtad15/255NELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSE
SAAFEELNMFNVKSNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIA
VRFPEAEASQSFSLVATPLSAGEILLSGFSTNEAKSLKVALNDTVSTPVGKLVVTPTLYY
ADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDVSIPRAEDVLNMLIA
V
DOMAINcd589/780TSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGSTNMGITNYLSGKVD
DINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLEALIEELKKRYDYIILDNVPAGLV
ADAAIVNRVADLTIYILRAGLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGY
GYGYGYGYGYGY
SITEWalker A596/598GKT
SITEWalker A'616/623ILVDLDIR
SITEWalker B698/704IILDNVP
SITE-695/-697YDY
SITEY Cluster759/780YNRSGYGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSEQETINLRREENELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEE
              NELNLSDLFHIVLANWYWFVLSVLVCAGVAVLYLKWAPKVYTRTASVLIKDNSKGGGLSESAAFEE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNMFNVKSNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILL
LNMFNVKSNVDNEVLVFKSKRLMSVVAERLNLDISYTIKDGLRTEELYTQSPIAVRFPEAEASQSFSLVATPLSAGEILL

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGFSTNEAKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDV
SGFSTNEAKSLKVALNDTVSTPVGKLVVTPTLYYADKYFGKAVTISKRNREEIALTYSNSLQVALASKTATIINLTLQDV

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIPRAEDVLNMLIAVYNEDAINDKNQVTVNTSNFINDRLIIIEEELGSVDADIETYKRENQLTDISSETGMYLQESSQYS
SIPRAEDVLNMLIAV                                                                 

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEGLGLENQVTLAKYIRDYLTDPHKSSDLIPANTGIADVNIEGQISEYNNLLLKRDKLIGNSSNKNPVVMDLNNSLSAMK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTIIRAIDNLIVGLNIKIKNIREREAQTSRRISAVPTQQKYVLSVERQQKIKEELYLYLLNKREENALSQAITESNARVI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DAAQGSRSPVAPKSMMILLAAVVLGLAIPAGIIWLQMVMNTTVRTRKDVEDAVSIPFLGEIPLRDKKNKDEIVVRENGRD


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SISEAFRIVRTNMDFMRVKAKDMKVVMFTSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGSTNMGIT
                            TSFNPNAGKTFVSMNLAMSFALTRKKVILVDLDIRKGTLSGHVSGSTNMGIT
                                   GKT                 ILVDLDIR                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYLSGKVDDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLEALIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
NYLSGKVDDINSIIKKEELATNLDIIHTGPVPPNPSELLLSDRLEALIEELKKRYDYIILDNVPAGLVADAAIVNRVADL
                                                         IILDNVP                
       730       740       750       760       770       780      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
TIYILRAGLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGYGNEKKK
TIYILRAGLMDRRQLPELEKLYRQGKFRNMSLVLNGVRYNRSGYGYGYGYGYGYGYGYGY      
                                      YNRSGYGYGYGYGYGYGYGYGY      

© 1998-2019