BYKdb

Annotate results for A0A0F5L4Y2

A0A0F5L4Y2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F5L4Y2
DOMAINtad4/178TDIDLRRVFALLQRQSRLIITTVIAVVTLAGIVAFALPPSFSSTALVLVDPSRKNLLDPD
QHASASSSDSARIDSEVEILRSNTVLLKVIEAVGLTGEGGPAAAPSLRQQVAAFFGLANT
SAPDTDPDAALNQTLESLRSAISIKRRGLTYVISIQARSSDPVQSAGLANALAQA
DOMAINcd417/607SSAAPDEGKSTLALALARSYALSGRRVLLIDCDLRKPSLHRHLHIEPSHGLMDYLDGDSN
DLASIISRDSLTSATIIIGAHVSDLPTDQLLTSAAFSRLMEAVRDTFEVVVIDTPPVGPV
VDSLYVAPFVDAIVFVTKWASTSQIEARQALTSLLDVKLPHAEVVAVINQQDQPRSVYRR
KYKGYYAEEAT
SITEWalker A424/426GKS
SITEWalker A'444/451LLIDCDLR
SITEWalker B526/532VVIDTPP
SITEY Cluster594/602YRRKYKGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDDTDIDLRRVFALLQRQSRLIITTVIAVVTLAGIVAFALPPSFSSTALVLVDPSRKNLLDPDQHASASSSDSARIDSEV
   TDIDLRRVFALLQRQSRLIITTVIAVVTLAGIVAFALPPSFSSTALVLVDPSRKNLLDPDQHASASSSDSARIDSEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EILRSNTVLLKVIEAVGLTGEGGPAAAPSLRQQVAAFFGLANTSAPDTDPDAALNQTLESLRSAISIKRRGLTYVISIQA
EILRSNTVLLKVIEAVGLTGEGGPAAAPSLRQQVAAFFGLANTSAPDTDPDAALNQTLESLRSAISIKRRGLTYVISIQA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RSSDPVQSAGLANALAQAYIDDQIAAKITRTLASRDILQARVAQARQAVVSAEGALAAFVRANAATGTADAAQANFTLNT
RSSDPVQSAGLANALAQA                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLAQQQLQQTFTSNLPADILTQTYGLQQSAEVARQQYETLLSRVHDLETQADLQVADSRLVSAALTPQSPSFPNRLLIVG


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAALLGLGLGVVLAVLYENYIGGFTSKAQMASVLRARVATAIPRQREQSDKQSLANLMIAEPLSVFAESVRRLRATLEQS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRRQADTGTGGKVVMISSAAPDEGKSTLALALARSYALSGRRVLLIDCDLRKPSLHRHLHIEPSHGLMDYLDGDSNDLAS
                SSAAPDEGKSTLALALARSYALSGRRVLLIDCDLRKPSLHRHLHIEPSHGLMDYLDGDSNDLAS
                       GKS                 LLIDCDLR                             
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IISRDSLTSATIIIGAHVSDLPTDQLLTSAAFSRLMEAVRDTFEVVVIDTPPVGPVVDSLYVAPFVDAIVFVTKWASTSQ
IISRDSLTSATIIIGAHVSDLPTDQLLTSAAFSRLMEAVRDTFEVVVIDTPPVGPVVDSLYVAPFVDAIVFVTKWASTSQ
                                             VVIDTPP                            
       570       580       590       600       
....:....|....:....|....:....|....:....|....:..
IEARQALTSLLDVKLPHAEVVAVINQQDQPRSVYRRKYKGYYAEEAT
IEARQALTSLLDVKLPHAEVVAVINQQDQPRSVYRRKYKGYYAEEAT
                                 YRRKYKGYY     
© 1998-2019