BYKdb

Annotate results for A0A0F5PHF2

A0A0F5PHF2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F5PHF2
DOMAINtad4/156LLPDPGHLWMVFRRHLWLFLGVVGVILALVALRTLTMVPIYTSTTSVVIEPRKNDVIKVQ
SVVPDLPAGSDIVDTEVRMITSPTLAMRVATDLSRQGYDIGPIATETQLERSAAALLRRV
AVVRAGLTYVIDITASSDNPDMAAAIANTFARQ
DOMAINcd500/688SSPLPQEGKTTTSVCLARTAALAGTSTVLVDCDLRRRGTSTMLLREPGPGLVEVLTGEAR
LDDALVLDEPTGLYVLGTSESPSSAFDPLTPGNLDKLIKQLKERFEFIVLDTAPVLGVAD
ARAVAAAVDSVLVITRWRKTSINAAETAIELLLDANANVAGLALTQVDIRRYASTGQSDV
YGYHKKFSG
SITEWalker A507/509GKT
SITEWalker A'527/534VLVDCDLR
SITEWalker B607/613IVLDTAP
SITEY Cluster680/690YGYHKKFSGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKGLLPDPGHLWMVFRRHLWLFLGVVGVILALVALRTLTMVPIYTSTTSVVIEPRKNDVIKVQSVVPDLPAGSDIVDTEV
   LLPDPGHLWMVFRRHLWLFLGVVGVILALVALRTLTMVPIYTSTTSVVIEPRKNDVIKVQSVVPDLPAGSDIVDTEV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RMITSPTLAMRVATDLSRQGYDIGPIATETQLERSAAALLRRVAVVRAGLTYVIDITASSDNPDMAAAIANTFARQYVAS
RMITSPTLAMRVATDLSRQGYDIGPIATETQLERSAAALLRRVAVVRAGLTYVIDITASSDNPDMAAAIANTFARQ    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKDAKVGATRSANVWLNRRLTELRAAAGAADAALQNYKIRNGLMSAQGATMAEQEVSALNQQISLARAELAEKQGRLSAA


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RAQLSRGGGGADVGASLSSGTVGGLRAREAEASQNLAQLESRYGPLYPEVKTAKSQLADIRAQIQQEIDRILSSLEAEVR


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VASSRLGSLQGSQSSARGSLASNSSAQVGYMELERRAEATKLIYEAFLNRSKETAAQEGLQQPDARIASFGAVPALPDSP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYQIAALFGIFAALFSGFVAVALAEYLQRGVRTKADVERRLRVRYAGAVPTLSSTLNGLRETEAPHDYIVSHPFSSFAES


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FRSLRAFVALRSRARALAISSPLPQEGKTTTSVCLARTAALAGTSTVLVDCDLRRRGTSTMLLREPGPGLVEVLTGEARL
                   SSPLPQEGKTTTSVCLARTAALAGTSTVLVDCDLRRRGTSTMLLREPGPGLVEVLTGEARL
                          GKT                 VLVDCDLR                          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDALVLDEPTGLYVLGTSESPSSAFDPLTPGNLDKLIKQLKERFEFIVLDTAPVLGVADARAVAAAVDSVLVITRWRKTS
DDALVLDEPTGLYVLGTSESPSSAFDPLTPGNLDKLIKQLKERFEFIVLDTAPVLGVADARAVAAAVDSVLVITRWRKTS
                                              IVLDTAP                           
       650       660       670       680       690  
....:....|....:....|....:....|....:....|....:....|..
INAAETAIELLLDANANVAGLALTQVDIRRYASTGQSDVYGYHKKFSGYYQN
INAAETAIELLLDANANVAGLALTQVDIRRYASTGQSDVYGYHKKFSG    
                                       YGYHKKFSGYY  
© 1998-2019