BYKdb

Annotate results for A0A0F5R3J7

A0A0F5R3J7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F5R3J7
DOMAINcd46/231TSCRAGEGKSTTSANMAVTFAQAGQKVLLIDADMRKPSQHHIFSLSNRGGLTGVLQGRST
LEQGVQAAEVDNLDILTAGPTPPNPSEMLGSRAMAALLELAKEQYDQVIVDTPPILAVTD
AHIVAGKCDGVVLVIDSGKVKSDTARKAKETLENAGSRMLGVVLNNVDRDGNSGYYYYYY
GGEEQA
SITEWalker A53/55GKS
SITEWalker A'73/80LLIDADMR
SITEWalker B153/159VIVDTPP
SITEY Cluster220/225YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRLTRNWTLITASNPKSPISESYRMLRTGVDYAGVDDPVDLLMVTSCRAGEGKSTTSANMAVTFAQAGQKVLLIDADMR
                                             TSCRAGEGKSTTSANMAVTFAQAGQKVLLIDADMR
                                                    GKS                 LLIDADMR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPSQHHIFSLSNRGGLTGVLQGRSTLEQGVQAAEVDNLDILTAGPTPPNPSEMLGSRAMAALLELAKEQYDQVIVDTPPI
KPSQHHIFSLSNRGGLTGVLQGRSTLEQGVQAAEVDNLDILTAGPTPPNPSEMLGSRAMAALLELAKEQYDQVIVDTPPI
                                                                        VIVDTPP 
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
LAVTDAHIVAGKCDGVVLVIDSGKVKSDTARKAKETLENAGSRMLGVVLNNVDRDGNSGYYYYYYGGEEQA
LAVTDAHIVAGKCDGVVLVIDSGKVKSDTARKAKETLENAGSRMLGVVLNNVDRDGNSGYYYYYYGGEEQA
                                                           YYYYYY      
© 1998-2019