BYKdb

Annotate results for A0A0F5R7R3

A0A0F5R7R3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F5R7R3
DOMAINcd46/231ASANPGEGKSTTASNLAVTYAQEGKKTLLIDADLRKPSVFQVFSVSNRVGLSTVVSGQCR
WADAIQDTHVEQLDVLPSGPIPPNPSELLASHSMKSLLQELQAQYDIIIFDTPPVLAVTD
SLIISSLCQGVILVVQAGKVKSELVRKAKSNLEHVQARILGVVLNNMKSRKGDKYTYYYY
GTKEAK
SITEWalker A53/55GKS
SITEWalker A'73/80LLIDADLR
SITEWalker B153/159IIFDTPP
SITEY Cluster220/225YTYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPRSTSESSLITYYEPKSPISEAYRTLRTNIQFSSFDEPIQVIMVASANPGEGKSTTASNLAVTYAQEGKKTLLIDADLR
                                             ASANPGEGKSTTASNLAVTYAQEGKKTLLIDADLR
                                                    GKS                 LLIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPSVFQVFSVSNRVGLSTVVSGQCRWADAIQDTHVEQLDVLPSGPIPPNPSELLASHSMKSLLQELQAQYDIIIFDTPPV
KPSVFQVFSVSNRVGLSTVVSGQCRWADAIQDTHVEQLDVLPSGPIPPNPSELLASHSMKSLLQELQAQYDIIIFDTPPV
                                                                        IIFDTPP 
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
LAVTDSLIISSLCQGVILVVQAGKVKSELVRKAKSNLEHVQARILGVVLNNMKSRKGDKYTYYYYGTKEAK
LAVTDSLIISSLCQGVILVVQAGKVKSELVRKAKSNLEHVQARILGVVLNNMKSRKGDKYTYYYYGTKEAK
                                                           YTYYYY      
© 1998-2019