BYKdb

Annotate results for A0A0F5YE28

A0A0F5YE28 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F5YE28
DOMAINtad7/155IDLDIGKYLQTVKRYWLIVISVFLLCVGLSVYGTKYLKPTYAASGKLLFKVDRTSSLAGI
GEGLGELKALLADQTPLSTQIEIISSNRLLNQVIEQLNLVDDEGKLIDPESIRKSLEVKI
IGGTDIVSLSYESPDPLEAANIVNTLMEV
DOMAINcd531/718TSSVPKEGKSTVSANLAATLAQLGYRVMLIDADMRQPSQHHLWGLTNAVGLSDILVGQAE
LSSVIRQGIERLDIIPSGVTPPNPLALLDSKRMTSLIRNFSEDYDFVIIDTPPLILAADA
LTLSQMASGVLLVARPKVLDRGSANSAKEMLERSGQRVLGLVVNAISKNESAQYFYHAKR
YFPSRKSN
SITEWalker A538/540GKS
SITEWalker A'558/565MLIDADMR
SITEWalker B637/643VIIDTPP
SITEY Cluster704/711YFYHAKRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEDRESIDLDIGKYLQTVKRYWLIVISVFLLCVGLSVYGTKYLKPTYAASGKLLFKVDRTSSLAGIGEGLGELKALLADQ
      IDLDIGKYLQTVKRYWLIVISVFLLCVGLSVYGTKYLKPTYAASGKLLFKVDRTSSLAGIGEGLGELKALLADQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPLSTQIEIISSNRLLNQVIEQLNLVDDEGKLIDPESIRKSLEVKIIGGTDIVSLSYESPDPLEAANIVNTLMEVYIQTN
TPLSTQIEIISSNRLLNQVIEQLNLVDDEGKLIDPESIRKSLEVKIIGGTDIVSLSYESPDPLEAANIVNTLMEV     

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VNMNQDEAREAREFISQQLPPVQQEVFRAEQALRSFKEKNQVLDLEEEFRTAVLEQAELNRKITVLESELSGVNALAESL


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTQAGFDLEEAIAINTLSQSPVLIGILTELENVESELVNERKRFKDQNPRIIALKQKRDSLNAALQEQVEQVLGSQAVVP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGLLQVPQGQKNNQLERFIANEIQRVELTRQLDSLYASRINYEQRSQNLPQLEQEQQELQRKVQVAQVTYETLLKNLEEV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVAENKSTNNARVIEEAIVPEEGSTAKTKLIALGIMLGLVGATTSVLILAMGDQNIRTVEEAKKTFGYTLLGIIPMFKNK


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFSDYFQGERASQQIPVVEASDSFISEIYRMLQANLKFLSSDKRIKTIVVTSSVPKEGKSTVSANLAATLAQLGYRVMLI
                                                  TSSVPKEGKSTVSANLAATLAQLGYRVMLI
                                                         GKS                 MLI
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADMRQPSQHHLWGLTNAVGLSDILVGQAELSSVIRQGIERLDIIPSGVTPPNPLALLDSKRMTSLIRNFSEDYDFVIID
DADMRQPSQHHLWGLTNAVGLSDILVGQAELSSVIRQGIERLDIIPSGVTPPNPLALLDSKRMTSLIRNFSEDYDFVIID
DADMR                                                                       VIID
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPPLILAADALTLSQMASGVLLVARPKVLDRGSANSAKEMLERSGQRVLGLVVNAISKNESAQYFYHAKRYFPSRKSNRR
TPPLILAADALTLSQMASGVLLVARPKVLDRGSANSAKEMLERSGQRVLGLVVNAISKNESAQYFYHAKRYFPSRKSN  
TPP                                                            YFYHAKRY         
       730     
....:....|....:
DLNQLNSQVNYYSKK


© 1998-2019