BYKdb

Annotate results for A0A0F5ZWP0

A0A0F5ZWP0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F5ZWP0
DOMAINtad14/206QLIDIGYYIHLLKKRWLSISFFTLLCTAIAALVALSITPTYRATATLLIESQQVKAISIE
EVVGIDSRANEYYLTQFEILKSNQVAQRVIDKLQLNQIEEFNPSIGANNEPGYKEQIKDW
LRSHPVIDSFFSSKEEMAIDPELEKEATNLKILKAFKSRLTISPIRKTQLVRISFDSKDP
KLAAEIANAVGYA
DOMAINcd553/741SSSVPGEGKTTTALNLAQSFASIEKVLLIDCDLRKPSVGIRFGLPNSHPGLTNILVMNAS
PNDCITTIEGTNLDVLPAGLIVANPQELLSGSSFHKLIEELGERYDRIIFDTPPILPVKD
AFIVGKLTKGIVLILKANSTSKSVYKHTMSLFTKHQISIDGVVINQVPQPKKGTHTYSEY
SRYAYGNME
SITEWalker A560/562GKT
SITEWalker A'579/586LLIDCDLR
SITEWalker B660/666IIFDTPP
SITEY Cluster729/737YSEYSRYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSAHPNETSVHQEQLIDIGYYIHLLKKRWLSISFFTLLCTAIAALVALSITPTYRATATLLIESQQVKAISIEEVVGIDS
             QLIDIGYYIHLLKKRWLSISFFTLLCTAIAALVALSITPTYRATATLLIESQQVKAISIEEVVGIDS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RANEYYLTQFEILKSNQVAQRVIDKLQLNQIEEFNPSIGANNEPGYKEQIKDWLRSHPVIDSFFSSKEEMAIDPELEKEA
RANEYYLTQFEILKSNQVAQRVIDKLQLNQIEEFNPSIGANNEPGYKEQIKDWLRSHPVIDSFFSSKEEMAIDPELEKEA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TNLKILKAFKSRLTISPIRKTQLVRISFDSKDPKLAAEIANAVGYAFIENNLESKLLATDKANGWLNERLTELKQNLNSS
TNLKILKAFKSRLTISPIRKTQLVRISFDSKDPKLAAEIANAVGYA                                  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQALVQFLQRQELIDNSGIAALTSNELQNLTDRIAEATDRRTKTQALYNALKSSPNADIATLSANALISNHPQVRDIRLA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESEAEKEVSQLSKRYGPKHDRMIQANARLKSVQRRAESLIYKLINGVEKELASAKEQEALLKQELLSKKEEFQSLSVVKS


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYDALKREVESNAKLYDLFLTRQKETSATSDFSAANARFSDHALVPQSPFKPNRKLIVVIALVASMGFACVLVICLDAFN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTISSARDFENKLGLLPTGTLPLVKAKEYKRNHIDASVFSNSKFAAFQESIDSIRTSLYLSMPKAERKFLALSSSVPGEG
                                                                        SSSVPGEG
                                                                               G
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTTTALNLAQSFASIEKVLLIDCDLRKPSVGIRFGLPNSHPGLTNILVMNASPNDCITTIEGTNLDVLPAGLIVANPQEL
KTTTALNLAQSFASIEKVLLIDCDLRKPSVGIRFGLPNSHPGLTNILVMNASPNDCITTIEGTNLDVLPAGLIVANPQEL
KT                LLIDCDLR                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSGSSFHKLIEELGERYDRIIFDTPPILPVKDAFIVGKLTKGIVLILKANSTSKSVYKHTMSLFTKHQISIDGVVINQVP
LSGSSFHKLIEELGERYDRIIFDTPPILPVKDAFIVGKLTKGIVLILKANSTSKSVYKHTMSLFTKHQISIDGVVINQVP
                   IIFDTPP                                                      
       730       740  
....:....|....:....|..
QPKKGTHTYSEYSRYAYGNMES
QPKKGTHTYSEYSRYAYGNME 
        YSEYSRYAY     

© 1998-2019