BYKdb

Annotate results for A0A0F6ACV3

A0A0F6ACV3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F6ACV3
DOMAINtad21/276SDIDLMALLGTLLDRKFFILANTVLFMMIGVCIAVFSTPIYQATSMIQVEEKGASVPGFD
ELGGMFESTSAAVTEIELLKSRTIIGEAVDALNLDVIAEPKLFPIFGGRSFRNFTPVQTD
ELADARFGASSYAWGGEEIDVFRFDVPKSAIDVEYTLISHGNGKFGLLDAGGEEFLRGRV
GEEVTNGLFTITLRALNARAGTEFTITKQERLKTILALQASIGAGEKGKDSGIINLSFQH
KNPTYAEDVLNKVAGI
DOMAINcd557/745SGPSPGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGMQWDNGLSDYLSGAIT
LEQATKKTQVEGLDLITRGQIPPNPSELLMHENFSKLVEEITAKYDLILIDTPPILAVTD
PAIVSAHAGTTLLVTRFGQNHVKELELTRNRFEQNGVDVKGVVFNGVVKKASNAYGYYGY
YNYEYKSDK
SITEWalker A564/566GKS
SITEWalker A'584/591LIIDADMR
SITEWalker B664/670ILIDTPP
SITEY Cluster731/741YGYYGYYNYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNAQSNLTTGAQSKQAVSQSSDIDLMALLGTLLDRKFFILANTVLFMMIGVCIAVFSTPIYQATSMIQVEEKGASVPGFD
                    SDIDLMALLGTLLDRKFFILANTVLFMMIGVCIAVFSTPIYQATSMIQVEEKGASVPGFD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELGGMFESTSAAVTEIELLKSRTIIGEAVDALNLDVIAEPKLFPIFGGRSFRNFTPVQTDELADARFGASSYAWGGEEID
ELGGMFESTSAAVTEIELLKSRTIIGEAVDALNLDVIAEPKLFPIFGGRSFRNFTPVQTDELADARFGASSYAWGGEEID

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VFRFDVPKSAIDVEYTLISHGNGKFGLLDAGGEEFLRGRVGEEVTNGLFTITLRALNARAGTEFTITKQERLKTILALQA
VFRFDVPKSAIDVEYTLISHGNGKFGLLDAGGEEFLRGRVGEEVTNGLFTITLRALNARAGTEFTITKQERLKTILALQA

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIGAGEKGKDSGIINLSFQHKNPTYAEDVLNKVAGIYVRRNVERNSAEAQKSLEFLEHQLPQVKKQLEAAEQRFNDYQVK
SIGAGEKGKDSGIINLSFQHKNPTYAEDVLNKVAGI                                            

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQSVDITLETEGVLRQIVKLETQLQELELKRLELGRKFKLSHPSYQAAIEQIDAVESQKKRLGREVKGLPETQQELLRLK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDVEVNNEIYTLLLAKTQELDIVRAGTVGNVRIIDEAQVNVSSPVKPKKALIVLMATLLGSLLAIVITIIQKAIHKGIED


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSEIEGLGLPVYSSVPYSEYQVKLTGFAKARKGKTAKAKSILAVDNPADLSIEALRSLRTSLHFAMMEAKNNIIAISGPS
                                                                            SGPS

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGMQWDNGLSDYLSGAITLEQATKKTQVEGLDLITRGQIPPN
PGVGKSFISVNLATVLAQSDKKVLIIDADMRKGYLQTQFGMQWDNGLSDYLSGAITLEQATKKTQVEGLDLITRGQIPPN
   GKS                 LIIDADMR                                                 
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PSELLMHENFSKLVEEITAKYDLILIDTPPILAVTDPAIVSAHAGTTLLVTRFGQNHVKELELTRNRFEQNGVDVKGVVF
PSELLMHENFSKLVEEITAKYDLILIDTPPILAVTDPAIVSAHAGTTLLVTRFGQNHVKELELTRNRFEQNGVDVKGVVF
                       ILIDTPP                                                  
       730       740      
....:....|....:....|....:.
NGVVKKASNAYGYYGYYNYEYKSDKK
NGVVKKASNAYGYYGYYNYEYKSDK 
          YGYYGYYNYEY     

© 1998-2019