BYKdb

Annotate results for A0A0F7BJW9

A0A0F7BJW9 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F7BJW9
DOMAINtad16/184TSAGLMLRARALWRRKWVVLGVAVVVAALSAVYTLRQPKVFSASTSLIIDVTAPRFLDGE
VKEVMGEERSNYWFNKEYYATQSEIITSRAVASRVVDKLGLSTDASYLGVAHISDEKTRV
QAMQGADAVGLLQSRIRVLPAKDSRVMNIAVDDLDAARAALLANEVANA
DOMAINcd533/722TSSGPQEGKSTTTISLGVAMAQSGNRVLLLDTDMRRPRLHRAFGVPNDLGISSLVVGEGT
LEAAVKSTEVPGLFLLPCGPLPPNPAELLHTRAFADLLKQVAGKFDRVLLDSPPLNAVAD
AAVLATQADGVVLVLKAGKTNRDSAQRALRSLADVQARMYGAVLNDVDLKAPGYGGTYIA
YQGYGQYAED
SITE-670/-672GKT
SITEWalker A'560/567LLLDTDMR
SITEWalker B640/646VLLDSPP
SITEY Cluster706/719YGGTYIAYQGYGQY
SITEWalker A540/542GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDGTVFDPAGGTGGPTSAGLMLRARALWRRKWVVLGVAVVVAALSAVYTLRQPKVFSASTSLIIDVTAPRFLDGEVKEVM
               TSAGLMLRARALWRRKWVVLGVAVVVAALSAVYTLRQPKVFSASTSLIIDVTAPRFLDGEVKEVM

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GEERSNYWFNKEYYATQSEIITSRAVASRVVDKLGLSTDASYLGVAHISDEKTRVQAMQGADAVGLLQSRIRVLPAKDSR
GEERSNYWFNKEYYATQSEIITSRAVASRVVDKLGLSTDASYLGVAHISDEKTRVQAMQGADAVGLLQSRIRVLPAKDSR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VMNIAVDDLDAARAALLANEVANAYMAENLALKLRMTDDARSWLESRLEDLENTSKASELAVYDFKKDADMLSTSLESRM
VMNIAVDDLDAARAALLANEVANA                                                        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIVSDRINSYNLNLTQVSTRIAALQARVEAIQKLRKASPDDETWAEALPGAKDGPIQDLRKSYTDARVACAELSERYLAE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HPKLLECQGKLAVIQADFLKSLRNVVRLAETELSEAEAQRKNLVKLLDEAKAEAFQVNKKSIEYDRLKRESDNNQRLYEL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLKRLKDIELSGLLRTSNVRVLDPARPQFVPVKPHVKRNLMVGMVLGLLAGLGAALLLDLLANTVASQEDVEGRLGLAFL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVMPRIEGNRPPKDRDLFVHREPKSSVAECCRAIRTNLLFMSPDTPFKTLVVTSSGPQEGKSTTTISLGVAMAQSGNRVL
                                                    TSSGPQEGKSTTTISLGVAMAQSGNRVL
                                                           GKS                 L
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDTDMRRPRLHRAFGVPNDLGISSLVVGEGTLEAAVKSTEVPGLFLLPCGPLPPNPAELLHTRAFADLLKQVAGKFDRV
LLDTDMRRPRLHRAFGVPNDLGISSLVVGEGTLEAAVKSTEVPGLFLLPCGPLPPNPAELLHTRAFADLLKQVAGKFDRV
LLDTDMR                                                                        V
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLDSPPLNAVADAAVLATQADGVVLVLKAGKTNRDSAQRALRSLADVQARMYGAVLNDVDLKAPGYGGTYIAYQGYGQYA
LLDSPPLNAVADAAVLATQADGVVLVLKAGKTNRDSAQRALRSLADVQARMYGAVLNDVDLKAPGYGGTYIAYQGYGQYA
LLDSPP                                                           YGGTYIAYQGYGQY 
       730
....:....|
EDPKDRVAQS
ED        

© 1998-2019