BYKdb

Annotate results for A0A0F7HJC4

A0A0F7HJC4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F7HJC4
DOMAINcd54/237TSSLPSAGKSTTAANVAIAYAQAGKKTLLLDADLRRPTTHYTFEMNNQKGLSTAIVNEMP
LENVIKETEIENLDIVTSGPVPPNPSELIASNKMEHFFKTVTMQYDMVIVDSPPILAVTD
GQLLSKLVDGTILVTNVESNNKDSLTHAKDLLHKADSNLIGVVLNNKKQKSSKDSYYYYY
GNEK
SITEWalker A61/63GKS
SITEWalker A'81/88LLLDADLR
SITEWalker B161/167VIVDSPP
SITEY Cluster229/233YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFGKKNKHLDYTSGPRDLIVAKEPKSPISEQYRTIRTNITYSSVDTPIKSVLFTSSLPSAGKSTTAANVAIAYAQAGKKT
                                                     TSSLPSAGKSTTAANVAIAYAQAGKKT
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLLDADLRRPTTHYTFEMNNQKGLSTAIVNEMPLENVIKETEIENLDIVTSGPVPPNPSELIASNKMEHFFKTVTMQYDM
LLLDADLRRPTTHYTFEMNNQKGLSTAIVNEMPLENVIKETEIENLDIVTSGPVPPNPSELIASNKMEHFFKTVTMQYDM
LLLDADLR                                                                        
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
VIVDSPPILAVTDGQLLSKLVDGTILVTNVESNNKDSLTHAKDLLHKADSNLIGVVLNNKKQKSSKDSYYYYYGNEK
VIVDSPPILAVTDGQLLSKLVDGTILVTNVESNNKDSLTHAKDLLHKADSNLIGVVLNNKKQKSSKDSYYYYYGNEK
VIVDSPP                                                             YYYYY    
© 1998-2019