BYKdb

Annotate results for A0A0F7HK70

A0A0F7HK70 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F7HK70
DOMAINcd52/237TSAVAGAGKSTIAANVAIAYAQAGKKTLLLDGDLRRPTCHYTFKVSNQKGLSTAIVNDIA
LEDLVNQTEFDDLDLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMIIVDSPPLLSVTD
AQLLSKSADGVILITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRTIKDKSKDDYYYY
QASHDV
SITEWalker A59/61GKS
SITEWalker A'79/86LLLDGDLR
SITEWalker B159/165IIVDSPP
SITEY Cluster228/231YYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRDRKMNNEVASAKKIIVATKPHSPVSEQFRTIRTNIMYSSIDRPIRSVLFTSAVAGAGKSTIAANVAIAYAQAGKKTLL
                                                   TSAVAGAGKSTIAANVAIAYAQAGKKTLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDGDLRRPTCHYTFKVSNQKGLSTAIVNDIALEDLVNQTEFDDLDLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMII
LDGDLRRPTCHYTFKVSNQKGLSTAIVNDIALEDLVNQTEFDDLDLITSGPIPPNPSELLSSKKLTQFIDHLKFQYEMII
LDGDLR                                                                        II
       170       180       190       200       210       220       230       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
VDSPPLLSVTDAQLLSKSADGVILITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRTIKDKSKDDYYYYQASHDV
VDSPPLLSVTDAQLLSKSADGVILITDVENNNRNHLLEAKDLLNKADANIIGLVLNNRTIKDKSKDDYYYYQASHDV
VDSPP                                                              YYYY      
© 1998-2019