BYKdb

Annotate results for A0A0F7KQC8

A0A0F7KQC8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F7KQC8
DOMAINtad13/182GDIDFGAVWAAIYRSRYWIGGIVIGALVLGVLVTLLTTPVYRAKATVQIDQEAAKILGTE
DTNMTAAIQDSDRFLQTQLDVIRSRSLTITIAEDLGFFDDPDFLVAMGYDPEVEAYGALT
AEQAKREQVIQTLSENLGVALPVDSRVASITFDSPDPELAAQIANSYAEN
DOMAINcd527/714TSAQQGEGKSSACFATALALGRVGKTVLLMDLDLRRPRQHHLFNLDNACGMSNLLTHNAT
ADEVIQKTEFEGISVIPSGGIAPNPTELLAGQTFREIVRKFEGLYDVVLIDSPPLLALAD
AVEIGSATDGSIFVIESARTSSSALRSAMERLRHGGGSILGAVLTKFDPKEAGYSYYYAY
DYQYKAGD
SITE-550/-552GKT
SITEWalker A'554/561LLMDLDLR
SITEWalker B634/640VLIDSPP
SITEY Cluster700/710YSYYYAYDYQY
SITEWalker A534/536GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIERGDDDRSLLGDIDFGAVWAAIYRSRYWIGGIVIGALVLGVLVTLLTTPVYRAKATVQIDQEAAKILGTEDTNMTAAI
            GDIDFGAVWAAIYRSRYWIGGIVIGALVLGVLVTLLTTPVYRAKATVQIDQEAAKILGTEDTNMTAAI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDSDRFLQTQLDVIRSRSLTITIAEDLGFFDDPDFLVAMGYDPEVEAYGALTAEQAKREQVIQTLSENLGVALPVDSRVA
QDSDRFLQTQLDVIRSRSLTITIAEDLGFFDDPDFLVAMGYDPEVEAYGALTAEQAKREQVIQTLSENLGVALPVDSRVA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SITFDSPDPELAAQIANSYAENYIRSNLQRKFDTSAYAREFLKGQLDEAAARLAESERQALEYARNTRVIDASNAAQSET
SITFDSPDPELAAQIANSYAEN                                                          

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRSGPSSLVTATLVQLNEAYAVALARRIEAEQKWNETRSQPVMALPEVLNNLAIQRLLEERAKLQASYEEQLQRRRQDHP


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VVKQAKASIDEIDRQISNIAVGIRQTVNSNYRAAVKQEQALEAQIAQLKTDTLDEQGKSVQLGILQRQTNNNRELYDLLL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRFNELNAEAGVQANNVAIVDRADIPDKPVVPNIPLNLALSLVGGIAFAGAFVFGREQFFDTVRTADDLTRKVGVAVLGV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPFVKGGVDVAEEAKDNKTTISEAFSSIRSSLMLSSSNGLPNSLMFTSAQQGEGKSSACFATALALGRVGKTVLLMDLDL
                                              TSAQQGEGKSSACFATALALGRVGKTVLLMDLDL
                                                     GKS                 LLMDLDL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRPRQHHLFNLDNACGMSNLLTHNATADEVIQKTEFEGISVIPSGGIAPNPTELLAGQTFREIVRKFEGLYDVVLIDSPP
RRPRQHHLFNLDNACGMSNLLTHNATADEVIQKTEFEGISVIPSGGIAPNPTELLAGQTFREIVRKFEGLYDVVLIDSPP
R                                                                        VLIDSPP
       650       660       670       680       690       700       710     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
LLALADAVEIGSATDGSIFVIESARTSSSALRSAMERLRHGGGSILGAVLTKFDPKEAGYSYYYAYDYQYKAGDN
LLALADAVEIGSATDGSIFVIESARTSSSALRSAMERLRHGGGSILGAVLTKFDPKEAGYSYYYAYDYQYKAGD 
                                                           YSYYYAYDYQY     

© 1998-2019