BYKdb

Annotate results for A0A0F7KUD6

A0A0F7KUD6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0F7KUD6
DOMAINtad27/180LLPDPGLLWQVFRRNILLFFLVVSVVLGLTALFLVIQTPQYLAQASLLIQPSSDPVRTSE
PGDPSGIVNADEVDTEIRLISSRLVAERAAALYADRFASPDGDRFTPAEIESLAATMSRA
TFVARSGQTRVVDIIAESSDPAFAATTANLIAEA
DOMAINcd526/714TSALPGEGKTTTSLCLSRTTAADGIRVVLVDADLRRRGASWALEYESETDIYDYLDGTAS
LNDCLHVDTRTGLHLLGSKSGQEGHRNPLTEGNVRRMFDELREHYDVIIIDTAPILGVAE
GRILATEADRVLLVTQWKKTSMRAVEAVSDMLVDANAKITGLALTQVNIKKYASTGDGDV
YAYTKKFRG
SITEWalker A533/535GKT
SITEWalker A'553/560VLVDADLR
SITEWalker B633/639IIIDTAP
SITE-577/-579YDY
SITEY Cluster706/716YAYTKKFRGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPNTETSEIAAESREAEAAQQSNALSLLPDPGLLWQVFRRNILLFFLVVSVVLGLTALFLVIQTPQYLAQASLLIQPSSD
                          LLPDPGLLWQVFRRNILLFFLVVSVVLGLTALFLVIQTPQYLAQASLLIQPSSD

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PVRTSEPGDPSGIVNADEVDTEIRLISSRLVAERAAALYADRFASPDGDRFTPAEIESLAATMSRATFVARSGQTRVVDI
PVRTSEPGDPSGIVNADEVDTEIRLISSRLVAERAAALYADRFASPDGDRFTPAEIESLAATMSRATFVARSGQTRVVDI

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IAESSDPAFAATTANLIAEAYLQSQVEAKTARSESSGEFINARLEELESNAIAAQAALDNYRAARGLVSANGSTNAEMEV
IAESSDPAFAATTANLIAEA                                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNLNTQLASARAELAEKRGRYNAARSQLSRGSGGADVGAALGSSTVGSLRQQEARVSAELAVLRERYGPLHPERRQAEQE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LADIRDRIQEEINRVLSNLQAEVQTAQSRVASLEGSRGAALSALQRNGQAQAGLSELEQKAEAAQAIYQSFLQRSQESGA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRDSALPDAVISAKAVVPQLPASPNYPLTVLIGLFLALVSGFSAILLAEYLRRGVQTKRDVERRLRLRYAGAIPSLKSTI


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGRAPLEAPHDYVCNHPHSLFAEAFRSIRTFLTLSAGTRPRVIAITSALPGEGKTTTSLCLSRTTAADGIRVVLVDADLR
                                             TSALPGEGKTTTSLCLSRTTAADGIRVVLVDADLR
                                                    GKT                 VLVDADLR
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RRGASWALEYESETDIYDYLDGTASLNDCLHVDTRTGLHLLGSKSGQEGHRNPLTEGNVRRMFDELREHYDVIIIDTAPI
RRGASWALEYESETDIYDYLDGTASLNDCLHVDTRTGLHLLGSKSGQEGHRNPLTEGNVRRMFDELREHYDVIIIDTAPI
                                                                        IIIDTAP 
       650       660       670       680       690       700       710        
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:...
LGVAEGRILATEADRVLLVTQWKKTSMRAVEAVSDMLVDANAKITGLALTQVNIKKYASTGDGDVYAYTKKFRGYYVD
LGVAEGRILATEADRVLLVTQWKKTSMRAVEAVSDMLVDANAKITGLALTQVNIKKYASTGDGDVYAYTKKFRG    
                                                                 YAYTKKFRGYY  

© 1998-2019