BYKdb

Annotate results for A0A0F7PWI3

A0A0F7PWI3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F7PWI3
DOMAINcd39/220TSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQLIRTGSIEMGLSDYLVGRA
QFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVI
DAAVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYY
HK
SITEWalker A46/48GKS
SITEWalker A'66/73LLIDADLR
SITEWalker B147/153VIIDTPP
SITEY Cluster213/218YYYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQKFELRLDDIDFQSQESFKTLRFNVEFSGEKNQVFYITSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
                                      TSTYPNEGKSTVSLELALAFSDNGKKALLIDADLRKSVSRQL
                                             GKS                 LLIDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
IRTGSIEMGLSDYLVGRAQFDDVIAQSNIENFSMIFSGPVPPNPSEILDGERFKHLIETVKEKFDIVIIDTPPMGSVIDA
                                                                  VIIDTPP       
       170       180       190       200       210       220
....:....|....:....|....:....|....:....|....:....|....:....|
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
AVIAKNCDGGIIVINSGQASYRQIRKTKEQLERADSKIIGCVLNKVDASNNDYYYGYYHK
                                                    YYYGYY  
© 1998-2019