BYKdb

Annotate results for A0A0F9BMP5

A0A0F9BMP5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F9BMP5
DOMAINcd8/197TSACPREGKTMLTLSLAMALNAMKDQRAVILDCDLRRSRIAELLNLSQGVALDSILLGQT
CPLDAVRVDERFGLHVIPVVYRDAYSPDHLSRSAFAEIIRELKTRYDYVLVDTPPVLAVA
DTGLLASHCDQTYMVVRWRKTRHAQIRDVFERLYDLDINVTGTILNFVNPKKEANYRGIP
YASYNEYRHV
SITEWalker A15/17GKT
SITEWalker A'36/43VILDCDLR
SITEWalker B116/122VLVDTPP
SITE-88/-115YRDAYSPDHLSRSAFAEIIRELKTRYDY
SITEY Cluster183/194YRGIPYASYNEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGQAIALTSACPREGKTMLTLSLAMALNAMKDQRAVILDCDLRRSRIAELLNLSQGVALDSILLGQTCPLDAVRVDERFG
       TSACPREGKTMLTLSLAMALNAMKDQRAVILDCDLRRSRIAELLNLSQGVALDSILLGQTCPLDAVRVDERFG
              GKT                  VILDCDLR                                     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHVIPVVYRDAYSPDHLSRSAFAEIIRELKTRYDYVLVDTPPVLAVADTGLLASHCDQTYMVVRWRKTRHAQIRDVFERL
LHVIPVVYRDAYSPDHLSRSAFAEIIRELKTRYDYVLVDTPPVLAVADTGLLASHCDQTYMVVRWRKTRHAQIRDVFERL
                                   VLVDTPP                                      
       170       180       190       
....:....|....:....|....:....|....:..
YDLDINVTGTILNFVNPKKEANYRGIPYASYNEYRHV
YDLDINVTGTILNFVNPKKEANYRGIPYASYNEYRHV
                      YRGIPYASYNEY   
© 1998-2019