BYKdb

Annotate results for A0A0F9C030

A0A0F9C030 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F9C030
DOMAINcd281/473SSSEPGDGKTTVISNLAVAYAQSGKRTLLIDADMRRPGLTPMLDLKGQKGLSTILRAGLP
VVQSAEANLCSSLLENLDVIPSGPRPINPTELLVGDRFSELLCWAESRYDQILVDSPPAL
VSDTAIIGRLVDGVLLTVQPHKNRRRTVIRAAESFSNLGINVLGIVINRLATEKSDDYYG
YGYGYGYGYGSGY
SITEWalker A288/290GKT
SITEWalker A'308/315LLIDADMR
SITEWalker B392/398ILVDSPP
SITEY Cluster458/475YYGYGYGYGYGYGSGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQHAFAMVDTIGREVLLRQLGLKTADPYASSRINQQLIDDRGKLQAKLLLYGSAHQEVRTLQQRISLAEHFLQNQRFQDA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQARQIIQQELGPALFDMARQQCDEAVASERAISAAYEEEKQAAVSLYGTLAELQIIERDLEHLHAFHETLLDRVKDLNL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQDKGIIRTSILTPPKTPGGPVWPNLSMIAMFSIAIGFGMGLGIVYIQDLLDDHFRSPEELRIQLGLPVLAMVGKLEPQT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NVGVDALHVHVQPNAVESEAFRTLRTALALAEGGSQRLVVSSSEPGDGKTTVISNLAVAYAQSGKRTLLIDADMRRPGLT
                                        SSSEPGDGKTTVISNLAVAYAQSGKRTLLIDADMRRPGLT
                                               GKT                 LLIDADMR     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PMLDLKGQKGLSTILRAGLPVVQSAEANLCSSLLENLDVIPSGPRPINPTELLVGDRFSELLCWAESRYDQILVDSPPAL
PMLDLKGQKGLSTILRAGLPVVQSAEANLCSSLLENLDVIPSGPRPINPTELLVGDRFSELLCWAESRYDQILVDSPPAL
                                                                       ILVDSPP  
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSDTAIIGRLVDGVLLTVQPHKNRRRTVIRAAESFSNLGINVLGIVINRLATEKSDDYYGYGYGYGYGYGSGYGYGHDDE
VSDTAIIGRLVDGVLLTVQPHKNRRRTVIRAAESFSNLGINVLGIVINRLATEKSDDYYGYGYGYGYGYGSGY       
                                                         YYGYGYGYGYGYGSGYGY     
       490       500    
....:....|....:....|....
PQSDAGLSEGSTDDMPMEIVRRVA


© 1998-2019