BYKdb

Annotate results for A0A0F9CMN4

A0A0F9CMN4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F9CMN4
DOMAINcd12/201TSAVPLEGKSTTALNLAVALAQKESKVLLIDADLRKPIIHKLLHLDNSTGLVDALLNGGH
PGASVKQSKNIDNLWVLTSGSVPSNPSELLGSSGMKALMEQVTKEYDYVVFDTPPLISVS
DGAILASQADGILMVVSPGKVKGEIGRHTKELLERIGTPVLGCVFNGVELSHRNYYYYYN
YYRYYAGSAG
SITEWalker A19/21GKS
SITEWalker A'39/46LLIDADLR
SITEWalker B120/126VVFDTPP
SITE-117/-119YDY
SITEY Cluster186/196YYYYYNYYRYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIDNPPKSLVITSAVPLEGKSTTALNLAVALAQKESKVLLIDADLRKPIIHKLLHLDNSTGLVDALLNGGHPGASVKQSK
           TSAVPLEGKSTTALNLAVALAQKESKVLLIDADLRKPIIHKLLHLDNSTGLVDALLNGGHPGASVKQSK
                  GKS                 LLIDADLR                                  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NIDNLWVLTSGSVPSNPSELLGSSGMKALMEQVTKEYDYVVFDTPPLISVSDGAILASQADGILMVVSPGKVKGEIGRHT
NIDNLWVLTSGSVPSNPSELLGSSGMKALMEQVTKEYDYVVFDTPPLISVSDGAILASQADGILMVVSPGKVKGEIGRHT
                                       VVFDTPP                                  
       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
KELLERIGTPVLGCVFNGVELSHRNYYYYYNYYRYYAGSAGEKKVGKREKKESNVLD
KELLERIGTPVLGCVFNGVELSHRNYYYYYNYYRYYAGSAG                
                         YYYYYNYYRYY                     
© 1998-2019