BYKdb

Annotate results for A0A0F9G9C6

A0A0F9G9C6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F9G9C6
DOMAINcd325/513SGPSPGVGKSFVSVNLAAVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGQLN
LEQVIKPTAVDGLSVITRGQIPPNPSELLMHSNFSKLVAEVSAAYDIVIVDTPPILAVTD
PAIVSAHTGTTLLVTRFGQNHIKEIELTRNRFEQNGTDVKGVVFNGVIKKASNAYGYYGY
YNYEYKSNE
SITEWalker A332/334GKS
SITEWalker A'352/359LIIDADMR
SITEWalker B432/438VIVDTPP
SITEY Cluster499/509YGYYGYYNYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NTILDLQAAIGASEKGKDSGIINLSLQSEKPHYAEKVLDKVAGIYVRRNVERNSAEAQKSLEFLEVQLPEIKKQLEFAEQ


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFNDYQIQRQSINITLETQGVLEQVVKLETKLQELELKRLELGRKFKKDHPTYQGIIEQIAAVNEQKKALVGEVGNLPET


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQELLRLRRDVEVSNQIYTLLLSKTQELDIVRAGTVGNVRIIDYAEVNTSKPVKPKKALIVVMTTMLGGMLAVAIVLVQK


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AMHKGVEDPNEIEAIGLPVYASVPYSDYQDKLTGFSKALKNKVSKPKSILALDNPADLSIEALRSLRTSLHFAMMEAKNN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIAISGPSPGVGKSFVSVNLAAVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGQLNLEQVIKPTAVDGLSVI
    SGPSPGVGKSFVSVNLAAVLAQSGKKVLIIDADMRKGYLQTQFGLKWDDGLSDYLSGQLNLEQVIKPTAVDGLSVI
           GKS                 LIIDADMR                                         
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRGQIPPNPSELLMHSNFSKLVAEVSAAYDIVIVDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRNRFEQNG
TRGQIPPNPSELLMHSNFSKLVAEVSAAYDIVIVDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRNRFEQNG
                               VIVDTPP                                          
       490       500       510     
....:....|....:....|....:....|....:
TDVKGVVFNGVIKKASNAYGYYGYYNYEYKSNEKS
TDVKGVVFNGVIKKASNAYGYYGYYNYEYKSNE  
                  YGYYGYYNYEY      
© 1998-2019