BYKdb

Annotate results for A0A0F9HWF5

A0A0F9HWF5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0F9HWF5
DOMAINcd390/578TSSNPTEGKSVTSSNLAVIMAQNGARTLLLDMDFRRPVLHKIFNVPQEKGFSNMLVGDAG
VDDVITHTNVPNLDVIPSGHIPPNPAELLSSDGIASFMDIFKSRYDRIVIDSPPILSATD
PVIISTFVDEVLMVIKMGETSRELVQTAIGKLHHVKANLIGTVLNGVDTGQGNYYQYQYY
GDRQPETEQ
SITEWalker A397/399GKS
SITEWalker A'417/424LLLDMDFR
SITEWalker B497/503IVIDSPP
SITEY Cluster563/569YYQYQYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVITSFLKRFDVKPVRNTQIAVVSFNSKSPEMAARVANAAVQAYVDYTLTTKIKANVGASGVLRKNIQEQRKKIEESEKL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFEYKEKFKIISLEEEKNITIQKLAAHSKNLVSAENVRIEAQSKYQVAVGMLVDGDLAGSIPEVMSNGFITKLKTDEAVL


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REQLSEISRKYGSKHPKVIALNDKISTVRGMIDDEIFRVVDSMKSQYDVALRNELALKGELVRLKEESQSLGKHAVAYSV


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LARDVYTNKEMYEVLLKRLKETSITGGMQTTNVRVLDEAIPPTIPFRPRRMLNILLAIVLGLFMGPVVAISFEYMDSSVK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TPEDIERYLRVPYLGPLPDFHGQESERAGGRSTMLVTSLDPKSVPAEAYRSIRTSIIFSSPDDKRTLLVTSSNPTEGKSV
                                                                     TSSNPTEGKSV
                                                                            GKS 
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSSNLAVIMAQNGARTLLLDMDFRRPVLHKIFNVPQEKGFSNMLVGDAGVDDVITHTNVPNLDVIPSGHIPPNPAELLSS
TSSNLAVIMAQNGARTLLLDMDFRRPVLHKIFNVPQEKGFSNMLVGDAGVDDVITHTNVPNLDVIPSGHIPPNPAELLSS
                LLLDMDFR                                                        
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DGIASFMDIFKSRYDRIVIDSPPILSATDPVIISTFVDEVLMVIKMGETSRELVQTAIGKLHHVKANLIGTVLNGVDTGQ
DGIASFMDIFKSRYDRIVIDSPPILSATDPVIISTFVDEVLMVIKMGETSRELVQTAIGKLHHVKANLIGTVLNGVDTGQ
                IVIDSPP                                                         
       570       580       590  
....:....|....:....|....:....|..
GNYYQYQYYGDRQPETEQGVFGRLRKPFLMRK
GNYYQYQYYGDRQPETEQ              
  YYQYQYY                       
© 1998-2019